Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR740 IGR745 IGR744 IGR743 IGR741 rnhB, - HD1026 HD1027 HD1034 HD1031 gcvA, - HD1028 cysB, - HD1030 argH, - HD1033 uvrD, - HD1032 rnhB, - HD1026 HD1027 HD1034 HD1031 gcvA, - HD1028 cysB, - HD1030 argH, - HD1033 uvrD, - HD1032 rnhB, - HD1026 HD1027 HD1034 HD1031 gcvA, - HD1028 cysB, - HD1030 argH, - HD1033 uvrD, - HD1032 HD1029 HD1029
* Calculated from Protein Sequence

Gene ID: HD1031

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
820784

Gene Stop:
821428

Gene Length:
645

Molecular Weight*:
25121

pI*:
9.80

Net Charge*:
5.91

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-214 are 58% similar to 15603488 unknown [Pasteurella
multocida]. Otherwise, a significant hit in gapped BLAST to a converved hypothetical protein: residues 28-207 are 34% similar to (AL162757) hypothetical protein of Neisseria meningitidis.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 28-207 are 61% similar to a (PROTEOME COMPLETE NMA1754 PM1623) protein domain (PD312868) which is seen in Q9CKJ3_PASMU.



Paralogs:  Local Blast Search
HD1031 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKFWQKFSVLCMTTLGLSSTVLAEDYNIKYSSNYLMPAYVHFKNEDGQYS
IQAKINVPLYNITFSAKGIEHNQQFHMLSYRDMRNDKMYALAEIDSTQIK
YGKAKGPLAEEALTMPTFDLFTLAFQLSYYDKLPENFQTTNGKKLYPTLN
VNLKKDQKQIKTKGQVYQEITYSFMTSDDKTVVVKKYEGEKFPRYISYHR
DGDKYELTFDRFVK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTTTGGCAAAAATTTAGCGTGTTATGTATGACAACGTTAGGGCT
TAGTTCAACTGTTTTAGCAGAGGATTACAATATTAAATACAGCTCAAACT
ATTTAATGCCCGCCTATGTACACTTCAAAAATGAGGACGGTCAATATAGT
ATTCAAGCTAAGATCAACGTGCCATTATATAATATTACTTTTTCTGCCAA
AGGCATTGAACATAATCAACAATTTCATATGTTAAGTTATCGTGATATGC
GTAACGATAAAATGTATGCATTAGCAGAGATTGATTCAACGCAGATTAAA
TATGGGAAAGCGAAAGGGCCGTTGGCGGAAGAAGCGCTCACTATGCCAAC
CTTTGATTTATTTACGTTAGCTTTTCAATTAAGTTATTACGATAAGTTAC
CGGAAAATTTTCAAACAACGAATGGTAAAAAATTATATCCAACGCTGAAT
GTTAATTTGAAAAAGGATCAAAAACAGATCAAAACTAAAGGTCAAGTATA
TCAAGAAATTACGTATAGCTTTATGACGAGCGATGATAAAACGGTGGTGG
TAAAAAAATACGAAGGTGAGAAATTCCCTCGTTACATTTCTTACCACCGA
GATGGCGATAAATATGAATTAACCTTTGATCGCTTTGTGAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy