Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR740 IGR744 IGR743 IGR741 rnhB, - HD1026 yfeC, - HD1025 HD1027 HD1031 gcvA, - HD1028 cysB, - HD1030 argH, - HD1033 uvrD, - HD1032 rnhB, - HD1026 yfeC, - HD1025 HD1027 HD1031 gcvA, - HD1028 cysB, - HD1030 argH, - HD1033 uvrD, - HD1032 rnhB, - HD1026 yfeC, - HD1025 HD1027 yfeD, - HD1024 yfeD, - HD1024 HD1031 gcvA, - HD1028 cysB, - HD1030 argH, - HD1033 uvrD, - HD1032 HD1029 HD1029
* Calculated from Protein Sequence

Gene ID: HD1029

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein (haloacid dehalogenase/epoxide hydrolase family)

Gene Start:
819117

Gene Stop:
819803

Gene Length:
687

Molecular Weight*:
26047

pI*:
5.00

Net Charge*:
-6.08

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-223 are 47% similar to 16767800 predicted haloacid
dehalogenase-like hydrolase [Salmonella typhimurium LT2].

Numerous weaker hits in gapped BLAST to conserved hypothetical protein; e.g. residues 2-223 are 45% similar to [2851600] hypothetical 25.3 kd protein in rimi-prfc intergenic region of E.coli, residues 1-223 are 31% similar to [7474574] conserved hypothetical protein of Bacillus subtilis, residues 7-197 are 29% similar to [7447713] conserved hypothetical protein of Thermotoga maritima.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1011
COG name: Predicted hydrolases of the HAD superfamily
Functional Class: R
The phylogenetic pattern of COG1011 is -mtKY-V-EB---j--o----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00413 (Haloacid dehalogenase/epoxide hydrolase family signature) with a combined E-value of 2.8e-06.
    PR00413A    4-15
    PR00413D    107-120
    PR00413E    138-154
    PR00413G    185-198


ProDom Summary:  Protein Domain Search
Residues 103-189 are 55% similar to a (PROTEOME COMPLETE HYDROLASE PHOSPHATASE DEHALOGENASE) protein domain (PD000816) which is seen in Q9CJW0_PASMU.

Residues 2-102 are 47% similar to a (PROTEOME COMPLETE VCA0608 PM1881) protein domain (PD404582) which is seen in Q9CJW0_PASMU.

Residues 151-224 are 37% similar to a (COMPLETE PROTEOME) protein domain (PD202150) which is seen in P94512_BACSU.



Paralogs:  Local Blast Search
HD1029 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 199 (E-value = 3.4e-24) place HD1029 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MMKYEWVLFDADETLFSFNAYMALNIMLKRYAIDFSQADYDAFQAVNKPL
WIAYQNNEITAKDIQMRRFAKLSAQTGIDPLVLNQQLMAEMALISKPLPG
VIEMLNELYGQVKMGIITNGFTELQQKRLQNTHTAHFFEIVVVSEQVGVA
KPDRQVFDYAFELIDGYDRTKVLMVGDTLASDILGGHNAGFDTCWFNQTQ
QHNQTAIRPTYEISLISQLVEIVKGNRL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAAATATGAGTGGGTGTTATTTGATGCGGATGAAACATTATTTTC
TTTTAATGCGTATATGGCGTTGAATATAATGTTAAAGCGTTATGCCATCG
ATTTTAGTCAGGCTGATTATGATGCCTTTCAAGCGGTGAATAAACCACTC
TGGATTGCCTATCAAAATAATGAAATTACTGCAAAAGATATTCAAATGCG
CCGTTTTGCAAAGTTATCGGCACAAACGGGTATTGATCCTTTAGTGCTTA
ATCAACAGTTAATGGCTGAAATGGCATTAATCAGTAAGCCTTTACCCGGT
GTTATTGAGATGCTAAATGAATTATATGGCCAAGTGAAAATGGGCATAAT
TACCAACGGTTTTACTGAGTTACAGCAAAAACGTTTACAAAATACCCATA
CGGCACATTTCTTTGAAATAGTGGTTGTTTCAGAACAAGTTGGAGTGGCT
AAGCCTGATCGCCAGGTATTTGATTATGCTTTTGAATTAATTGATGGATA
TGATCGTACCAAAGTACTGATGGTTGGTGATACATTAGCGTCTGATATTT
TAGGCGGTCATAATGCTGGTTTTGATACTTGTTGGTTTAATCAAACCCAA
CAGCACAATCAAACCGCGATTCGTCCTACCTATGAGATTAGTTTAATCAG
CCAGTTAGTTGAGATAGTAAAAGGAAATAGGCTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy