Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR740 IGR738 IGR737 IGR741 HD1023 rnhB, - HD1026 licA, - HD1021 yfeC, - HD1025 HD1027 HD1020 HD1031 gcvA, - HD1028 cysB, - HD1030 macB, - HD1019 HD1023 rnhB, - HD1026 licA, - HD1021 yfeC, - HD1025 HD1027 HD1020 HD1031 gcvA, - HD1028 cysB, - HD1030 macB, - HD1019 rnhB, - HD1026 licA, - HD1021 yfeC, - HD1025 HD1027 HD1022 yfeD, - HD1024 yfeD, - HD1024 HD1023 HD1022 HD1020 HD1031 gcvA, - HD1028 cysB, - HD1030 macB, - HD1019 HD1029 HD1029
* Calculated from Protein Sequence

Gene ID: HD1026

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rnhB  

Definition:
ribonuclease HII (RNase HII)

Gene Start:
816663

Gene Stop:
816070

Gene Length:
594

Molecular Weight*:
21579

pI*:
9.70

Net Charge*:
4.39

EC:
3.1.26.4  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Secondary Evidence:
Itaya,M.
Isolation and characterization of a second RNase H (RNase HII) of
Escherichia coli K-12 encoded by the rnhB gene
Proc. Natl. Acad. Sci. U.S.A. 87 (21), 8587-8591 (1990)
MEDLINE: 91046040

Ohtani,N., Haruki,M., Morikawa,M., Crouch,R.J., Itaya,M. and
Kanaya,S.
Identification of the genes encoding Mn2+-dependent RNase HII and
Mg2+-dependent RNase HIII from Bacillus subtilis: classification of RNases H into three families
Biochemistry 38 (2), 605-618 (1999)
MEDLINE: 99105810


Comment:
For the rnh (HI) gene, see HD1206.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ribonuclease HII protein; e.g. residues 40-223 are 76% similar to (U32786) ribonuclease HII of Haemophilus influenzae, residues 33-225 are 72% similar to (U70214) ribonuclease HII of Escherichia coli, residues 33-224 are 71% similar to (U70214) ribonuclease HII of Escherichia coli.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0164
COG name: Ribonuclease HII
Functional Class: L
The phylogenetic pattern of COG0164 is amtkyqvcebrhuj--o-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001352 (Ribonuclease HII) with a combined E-value of 1.3e-35.
    IPB001352A    15-29
    IPB001352B    46-55
    IPB001352C    125-145
    IPB001352D    165-179


ProDom Summary:  Protein Domain Search
Residues 15-149 are 32% similar to a (RNASE RIBONUCLEASE SUBUNIT HI) protein domain (PD003015) which is seen in RNH2_PYRKO.

Residues 12-188 are 81% similar to a (HII RIBONUCLEASE HYDROLASE RNASE) protein domain (PD005501) which is seen in RNH2_PASMU.



Paralogs:  Local Blast Search


HD1026 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 14 to 191 (E-value = 1.6e-89) place HD1026 in the RNase_HII family which is described as Ribonuclease HII (PF01351)

PDB Hit:
pdb|1EKE|A Chain A, Crystal Structure Of Class Ii Ribonuclease ... 183 2e-047

Gene Protein Sequence:
MRTNFIYHNANLIAGVDEVGRGPLVGAVVTAAVILDPQQPILGLADSKKL
SEKKRILLATEIKQKALCWSLGRAEAEEIDQLNILHATMLAMQRAINALT
IQPDFVLVDGNRIPSLNMPAQAIVKGDSLVAEISAASILAKVARDHEMQI
LDQQFPEYGFAQHKGYPTKLHIEKLAQFGATPFHRKSFAPVRKILGL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAACGAATTTCATTTATCATAATGCGAACTTAATCGCAGGAGTGGA
CGAAGTCGGCAGAGGTCCATTAGTCGGGGCCGTAGTCACGGCAGCGGTTA
TTTTAGATCCACAACAGCCTATTTTAGGTTTAGCGGACTCTAAAAAATTG
TCTGAGAAAAAACGTATATTACTAGCCACAGAAATCAAACAGAAAGCACT
TTGTTGGTCATTAGGTCGTGCCGAAGCTGAAGAAATTGATCAATTAAATA
TCCTGCATGCTACGATGTTAGCTATGCAACGTGCCATTAATGCATTAACT
ATTCAACCTGATTTTGTGCTAGTCGATGGCAATCGTATTCCCTCGCTAAA
TATGCCCGCTCAAGCGATCGTAAAAGGAGACAGTTTAGTTGCTGAAATCA
GTGCTGCATCTATTTTAGCCAAAGTTGCTCGTGATCACGAGATGCAAATC
TTAGATCAACAATTTCCTGAATATGGTTTTGCGCAACACAAAGGTTATCC
AACTAAACTACATATTGAGAAACTGGCACAATTTGGTGCAACGCCTTTTC
ATCGTAAAAGTTTTGCACCTGTGCGAAAGATATTAGGGTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy