Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR732 IGR729 IGR733 IGR735 IGR730 IGR736 IGR737 IGR731 IGR734 HD1012 HD1015 HD1013 HD1014 licA, - HD1021 HD1011 HD1017 HD1020 mtrC, - HD1018 prc, - HD1010 macB, - HD1019 HD1012 HD1015 HD1013 HD1014 licA, - HD1021 HD1011 HD1017 HD1020 mtrC, - HD1018 prc, - HD1010 macB, - HD1019 HD1012 HD1014 HD1016 HD1015 HD1013 HD1016 HD1011 HD1017 HD1020 mtrC, - HD1018 prc, - HD1010 macB, - HD1019
* Calculated from Protein Sequence

Gene ID: HD1017

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
807599

Gene Stop:
808030

Gene Length:
432

Molecular Weight*:
16339

pI*:
10.20

Net Charge*:
6.41

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 2-142 are 37% similar to residues 85-228 of 15214146|OM24_PASMU 24 kDa outer membrane protein and are 37% similar to residues 102-245 of 15602863 unknown [Pasteurella
multocida].


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-105 are 42% similar to a (MEMBRANE OUTER PRECURSOR SIGNAL) protein domain (PD023731) which is seen in Q9CM45_PASMU.



Paralogs:  Local Blast Search
HD1017 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MVFIQFGDGFRLKAKSYSHNYNSIDNCYPQMVFGDALAYTLDFFRLDTTS
LSFQIRAGKRGSSTEILSSTAVPITRKFFISPSIGANYYSAKYTNYYFGI
KPHELGGEIRLIYKLKYSYSSYASIDFTYTLTVSLVGKFVSWF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTATTTATCCAATTTGGCGATGGTTTTCGATTAAAAGCAAAGAGTTA
CTCTCACAATTATAATAGTATAGACAATTGTTACCCTCAAATGGTTTTCG
GTGATGCTCTTGCTTATACACTAGATTTCTTTAGATTAGATACGACTTCC
TTATCTTTCCAGATTAGAGCGGGTAAACGTGGTAGTAGCACTGAAATTTT
ATCAAGTACAGCAGTTCCTATAACAAGGAAATTTTTTATTTCTCCATCTA
TCGGCGCAAATTACTATTCAGCAAAATATACAAATTATTATTTTGGGATT
AAACCACATGAATTAGGTGGCGAGATTCGTTTAATCTATAAGCTTAAATA
CTCTTATTCTTCTTATGCCAGTATTGATTTTACTTATACCTTAACGGTAT
CATTGGTTGGCAAATTTGTCAGCTGGTTTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy