Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR726 IGR721 IGR723 IGR728 IGR725 IGR729 IGR724 IGR722 IGR730 IGR719 IGR727 IGR720 IGR731 HD1012 HD1000 cspC, - HD1008 HD1001 thyA, - HD1005 HD1011 hupA, - HD1004 HD1009 HD1002 HD1006 HD1003 bioB, - HD1007 prc, - HD1010 HD1012 HD1000 cspC, - HD1008 HD1001 thyA, - HD1005 HD1011 hupA, - HD1004 HD1009 HD1002 HD1006 HD1003 bioB, - HD1007 prc, - HD1010 HD1012 HD1000 cspC, - HD1008 HD1001 thyA, - HD1005 HD1011 hupA, - HD1004 HD1009 HD1002 HD1006 HD1003 bioB, - HD1007 prc, - HD1010
* Calculated from Protein Sequence

Gene ID: HD1007

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
bioB  

Definition:
biotin synthetase

Gene Start:
799853

Gene Stop:
800857

Gene Length:
1005

Molecular Weight*:
37336

pI*:
5.30

Net Charge*:
-8.86

EC:
2.8.1.6  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Biotin metabolism

Secondary Evidence:
Otsuka,A.J., Buoncristiani,M.R., Howard,P.K., Flamm,J., Johnson,C.,Yamamoto,R., Uchida,K., Cook,C., Ruppert,J. and Matsuzaki,J.
The Escherichia coli biotin biosynthetic enzyme sequences predicted from the nucleotide sequence of the bio operon
J. Biol. Chem. 263 (36), 19577-19585 (1988)
Medline: 89066784

Ugulava NB, Surerus KK, Jarrett JT.
Evidence from Mossbauer spectroscopy for distinct [2Fe-2S](2+) and [4Fe-4S](2+) cluster binding sites in biotin
synthase from Escherichia coli.
J Am Chem Soc. 2002 Aug 7;124(31):9050-1.
PMID: 12148999

Ollagnier-De-Choudens S, Mulliez E, Hewitson KS, Fontecave M.
Biotin synthase is a pyridoxal phosphate-dependent cysteine desulfurase.
Biochemistry. 2002 Jul 23;41(29):9145-52.
PMID: 12119030

Farh L, Hwang SY, Steinrauf L, Chiang HJ, Shiuan D.
Structure-function studies of Escherichia coli biotin synthase via a chemical modification and site-directed mutagenesis
approach.
J Biochem (Tokyo). 2001 Nov;130(5):627-35.
PMID: 11686925



Comment:
For other biotin-related genes, see HD0634, HD0635, HD0082, HD1394, HD1480, HD1680, HD1681.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to biotin synthetase protein sequences,e.g.residues 12-328 are 78% similar to biotin synthetase in Haemophilus influenzae strain Rd KW20 (1168665|).

Residues 23-330 are 59% similar to biotin synthetase in Escherichia coli (2506981|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0502
COG name: Biotin synthase and related enzymes
Functional Class:  H
The phylogenetic pattern of COG0502 is -MT-yqvcebrhuj-----n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002684 (Biotin synthase) with a combined E-value of 3.7e-101.
    IPB002684A    69-80
    IPB002684B    101-120
    IPB002684C    139-185
    IPB002684D    188-224
    IPB002684E    232-248
    IPB002684F    270-281
    IPB002684G    307-317


ProDom Summary:  Protein Domain Search
Residues 22-326 are 77% similar to a (BIOTIN SYNTHASE SYNTHETASE IRON-SULFUR) protein domain (PD003026) which is seen in Q9JRW7_NEIMB.



Paralogs:  Local Blast Search

HD1007 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 63 to 225 (E-value = 2.6e-25) place HD1007 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)
Residues 236 to 328 (E-value = 1.1e-45) place HD1007 in the BATS family which is described as Biotin and Thiamin Synthesis associated domain (PF06968)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTTYNLRLKAKDELTPHPSVQYWRKCQVEELFAMPFMELVFKAAQVHREH
FDPQAIQLSTLLSIKTGGCPEECEYCPQSARYDTGLEKQVMLDIEEIVEK
AKIAKQRGASRFCMGAAWRGPKPKDIKVVSEIIGAVKALGLETCGTFGLL
EDGMAEDLKQAGLDYYNHNLDTDPERYSKVVHTRSHDDRMDTLGKVRHAG
LKVCCGGIVGMNETRPERAGLIASLANLDPQPESVPINQLIKVEGTPMAE
AEDLDWTEFVRTIAVARITMPKSYVRLSAGRTAMSEAMQTLCFIAGANSI
FYGEKLLTTCNPEEDADCLLMQKLDLYPLQYQEC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACCTACAATTTACGCTTAAAAGCAAAAGATGAACTCACGCCTCA
TCCTAGCGTGCAATATTGGCGTAAATGCCAAGTAGAAGAATTATTTGCCA
TGCCATTTATGGAGCTTGTTTTTAAAGCAGCACAAGTACACCGTGAACAC
TTTGATCCTCAAGCTATTCAGCTATCGACATTACTGTCAATTAAAACCGG
TGGTTGTCCAGAAGAGTGTGAATATTGTCCTCAATCTGCACGTTATGATA
CAGGGCTTGAAAAGCAAGTTATGCTAGATATTGAAGAAATTGTGGAGAAA
GCAAAAATTGCTAAACAACGAGGTGCTAGTCGCTTTTGTATGGGGGCCGC
TTGGCGAGGGCCTAAACCTAAGGATATTAAAGTGGTTTCCGAAATTATTG
GTGCAGTTAAAGCGTTAGGTTTAGAAACGTGTGGTACTTTTGGACTCTTA
GAAGATGGAATGGCAGAAGATCTCAAACAAGCGGGATTAGATTATTATAA
TCATAATTTAGATACTGATCCCGAACGTTATAGCAAAGTGGTTCATACCC
GCAGTCATGATGATCGAATGGATACCTTAGGTAAAGTTCGTCATGCAGGA
CTAAAAGTTTGCTGTGGTGGTATTGTTGGCATGAATGAAACCCGCCCTGA
ACGTGCAGGTTTAATTGCCAGTTTAGCAAATTTAGATCCACAGCCAGAAA
GTGTGCCAATTAATCAATTAATTAAAGTAGAAGGCACACCAATGGCTGAA
GCAGAAGACCTAGATTGGACGGAATTTGTTCGCACTATTGCTGTTGCGCG
TATCACTATGCCAAAAAGCTATGTACGATTATCAGCCGGCCGAACAGCAA
TGTCCGAAGCTATGCAAACACTCTGTTTTATAGCGGGAGCGAACTCTATT
TTCTATGGTGAAAAACTGCTCACAACTTGCAATCCAGAGGAAGATGCAGA
TTGTTTATTGATGCAAAAACTTGATTTATATCCATTACAATATCAAGAAT
GCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy