Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR726 IGR721 IGR723 IGR728 IGR725 IGR724 IGR722 IGR718 IGR719 IGR727 IGR720 HD1000 cspC, - HD1008 HD1001 thyA, - HD1005 putP, - HD0999 hupA, - HD1004 HD1009 HD1002 HD1006 HD1003 bioB, - HD1007 prc, - HD1010 HD1000 cspC, - HD1008 HD1001 thyA, - HD1005 putP, - HD0999 hupA, - HD1004 HD1009 HD1002 HD1006 HD1003 bioB, - HD1007 prc, - HD1010 HD1000 cspC, - HD1008 HD1001 thyA, - HD1005 putP, - HD0999 hupA, - HD1004 HD1009 HD1002 HD1006 HD1003 bioB, - HD1007 prc, - HD1010
* Calculated from Protein Sequence

Gene ID: HD1005

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
thyA  

Definition:
thymidylate synthase

Gene Start:
799091

Gene Stop:
798240

Gene Length:
852

Molecular Weight*:
32404

pI*:
7.30

Net Charge*:
1.17

EC:
2.1.1.45  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Folate biosynthesis
One carbon pool by folate
Pyrimidine metabolism

Secondary Evidence:
Myllykallio H, Lipowski G, Leduc D, Filee J, Forterre P, Liebl U.
An alternative flavin-dependent mechanism for thymidylate synthesis.
Science. 2002 Jul 5;297(5578):105-7.
PMID: 12029065

Viswanathan M, Lacirignola JJ, Hurley RL, Lovett ST.
A novel mutational hotspot in a natural quasipalindrome in Escherichia coli.
J Mol Biol. 2000 Sep 22;302(3):553-64.
PMID: 10986118

Fu X, Xu JG.
Development of a chromosome-plasmid balanced lethal system for Lactobacillus acidophilus with thyA gene as selective marker.
Microbiol Immunol. 2000;44(7):551-6.
PMID: 10981827

Comment:
This protein provides the sole de novo source of DTMP for DANA biosynthesis.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to thymidylate synthetase sequences,e.g.residues 1-283 are 69% similar to thymidylate synthase in Haemophilus influenzae strain Rd KW20 (1174840|).



COGS Summary:  COGS Search
BeTs to 7 clades of COG0207
COG name: Thymidylate synthase
Functional Class:  F
The phylogenetic pattern of COG0207 is amt-y---eBrh--gp-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000398 (Thymidylate synthase) with a combined E-value of 2.1e-70.
    IPB000398A    3-31
    IPB000398B    44-70
    IPB000398C    102-115
    IPB000398D    123-164
    IPB000398E    165-219
    IPB000398F    260-283


ProDom Summary:  Protein Domain Search
Residues 1-283 are 74% similar to a (SYNTHASE THYMIDYLATE TRANSFERASE) protein domain (PD001180) which is seen in TYSY_VIBCH.



Paralogs:  Local Blast Search

HD1005 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 283 (E-value = 5.8e-102) place HD1005 in the Thymidylat_synt family which is described as Thymidylate synthase (PF00303)

PDB Hit:
pdb|1HW4|A Chain A, Structure Of Thymidylate Synthase Suggests ... 131 1e-031
pdb|1HVY|A Chain A, Human Thymidylate Synthase Complexed With D... 130 3e-031
pdb|1RTS|B Chain B, Thymidylate Synthase From Rat In Ternary Co... 129 3e-031

Gene Protein Sequence:
MKQYLDLCHRILNEGKWVKNKRTDKLCLTVINADLTYDVAKGEFPLITTR
KSFWKAAIAELLGYIRGYDNAADFRQLGTKSWDANANQNADWLANPYRKG
VDDMGLVYGAIGRKFPKADHGSLDLLKQIVDDLSNGIDNRGEIYTFYHPG
AFHMGCLRPCLYSHHFSLLDGTLYLNSTQRSADVPLGLNWNMVQCYTFLA
LMAQITNHKAGQVFHKIVNAHIYEDQLALMRDVQLKREPFATPTLTINPA
IKSLEDLEIWVTLDDFKVENYFYHPSIQYPFSI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAATATTTAGATCTATGCCATCGTATCCTAAATGAAGGGAAATG
GGTAAAAAACAAGCGAACTGATAAACTATGCTTAACCGTTATTAATGCCG
ACCTAACTTATGATGTCGCAAAAGGTGAATTCCCGCTTATTACTACTCGT
AAAAGTTTTTGGAAAGCCGCCATTGCTGAGCTACTAGGCTATATACGTGG
CTATGACAACGCGGCAGATTTTCGCCAATTAGGAACAAAATCTTGGGATG
CAAATGCCAATCAAAACGCTGATTGGTTAGCCAATCCATATCGCAAAGGA
GTCGATGATATGGGATTAGTGTATGGCGCAATCGGTAGAAAATTTCCTAA
AGCAGATCATGGTTCGCTTGATTTACTTAAACAAATTGTTGATGATTTAA
GCAATGGCATTGATAATCGTGGCGAAATTTATACTTTCTATCATCCGGGT
GCTTTTCATATGGGGTGCTTACGCCCTTGTTTATATAGCCACCATTTTTC
ATTATTAGACGGTACATTATATCTAAATAGCACGCAACGTTCTGCAGATG
TGCCATTAGGTTTAAATTGGAATATGGTTCAATGCTATACATTTTTAGCA
TTAATGGCACAAATTACTAATCATAAAGCAGGACAAGTTTTTCATAAAAT
CGTTAATGCACATATTTATGAAGATCAACTCGCTTTAATGCGTGATGTAC
AGCTAAAACGTGAACCATTTGCGACTCCCACGCTTACCATCAATCCAGCG
ATTAAGTCATTAGAAGATTTAGAAATTTGGGTTACGCTCGATGACTTTAA
AGTGGAAAACTACTTTTACCATCCAAGTATTCAATACCCCTTTTCTATTT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy