Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR713 IGR707 IGR708 IGR711 IGR709 IGR710 IGR714 IGR712 HD0993 act, - HD0989 focA, - HD0991 potD, - HD0994 HD0995 prlC, - HD0988 pflB,pfl, - HD0990 HD0986 HD0992 hpaB, - HD0987 HD0993 act, - HD0989 focA, - HD0991 potD, - HD0994 HD0995 prlC, - HD0988 pflB,pfl, - HD0990 HD0986 HD0992 hpaB, - HD0987 HD0993 act, - HD0989 focA, - HD0991 potD, - HD0994 HD0995 prlC, - HD0988 pflB,pfl, - HD0990 HD0992 hpaB, - HD0987 HD0986
* Calculated from Protein Sequence

Gene ID: HD0990

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pflB  pfl  

Definition:
formate acetyltransferase

Gene Start:
787475

Gene Stop:
785163

Gene Length:
2313

Molecular Weight*:
86410

pI*:
5.70

Net Charge*:
-11.93

EC:
2.3.1.54  

Functional Class:
Energy metabolism; Fermentation  

Pathway: pathway table
Butanoate metabolism
Pyruvate metabolism

Secondary Evidence:
Sawers,G. and Bock,A.
Novel transcriptional control of the pyruvate formate-lyase gene:
upstream regulatory sequences and multiple promoters regulate
anaerobic expression
J. Bacteriol. 171 (5), 2485-2498 (1989)
M:89213931

Wagner,A.F., Frey,M., Neugebauer,F.A., Schafer,W. and Knappe,J.
The free radical in pyruvate formate-lyase is located on
glycine-734
Proc. Natl. Acad. Sci. U.S.A. 89 (3), 996-1000 (1992)
M:92141244

Molloy,M.P., Herbert,B.R., Walsh,B.J., Tyler,M.I., Traini,M.,
Sanchez,J.C., Hochstrasser,D.F., Williams,K.L. and Gooley,A.A.
Extraction of membrane proteins by differential solubilization for
separation using two-dimensional gel electrophoresis
Electrophoresis 19 (5), 837-844 (1998)
M:98291876

Becker,A., Fritz-Wolf,K., Kabsch,W., Knappe,J., Schultz,S. and
Volker Wagner,A.F.
Structure and mechanism of the glycyl radical enzyme pyruvate
formate-lyase
Nat. Struct. Biol. 6 (10), 969-975 (1999)
M:99436526


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to formate acetyltransferase (pyruvate formate lyase) proteins; e.g., residues 1-770 are 82% similar to PFLB_HAEIN [1172448], residues 1-770 are 77% similar to PFLB_ECOLI [129879], and residues 2-770 are 69% similar to to sequence for pyruvate formate-lyase Pfl in Aeromonas hydrophila [5814107].

COGS Summary:  COGS Search
BeTs to 3 clades of COG1882
COG name: Pyruvate-formate lyase
Functional Class:  C
The phylogenetic pattern of COG1882 is a-t-----E--H---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001150 (Pyruvate formate-lyase, glycine radical) with a combined E-value of 6.8e-39.
    IPB001150A    613-623
    IPB001150B    719-768


ProDom Summary:  Protein Domain Search
Residues 710-770 are 90% similar to a (RADICAL PYRUVATE ORGANIC FORMATE) protein domain (PD004056) which is seen in PFLB_HAEIN.

Residues 526-690 are 79% similar to a (PYRUVATE ACETYLTRANSFERASE FORMATE) protein domain (PD005492) which is seen in PFLB_ECOLI.

Residues 575-706 are 38% similar to a (PYRUVATE FORMATE-LYASE) protein domain (PD332474) which is seen in O66391_STRBO.

Residues 526-574 are 95% similar to a (ACETYLTRANSFERASE FORMATE PYRUVATE) protein domain (PD254584) which is seen in PFLB_HAEIN.



Paralogs:  Local Blast Search


HD0990 is paralogously related to HD1064 (7e-25).


Pfam Summary:  Pfam Search
Residues 640 to 751 (E-value = 4.8e-65) place HD0990 in the Gly_radical family which is described as Glycine radical (PF01228)

PDB Hit:
pdb|3PFL|A Chain A, Crystal Structure Of Pfl From E.Coli In Com... 1234 0.0
pdb|1CM5|A Chain A, Crystal Structure Of C418a,C419a Mutant Of ... 1227 0.0
pdb|1QHM|A Chain A, Escherichia Coli Pyruvate Formate Lyase Lar... 1012 0.0

Gene Protein Sequence:
MIQLDEAQQKAWAGFVAGTWQTEVNVRDFIQKNYTPYEGDESFLAGATPA
TTKLWQEVMEKIKVENKTHEPYDIDCDIPSTITSHKPGYIDQSLEKIVGL
QTDAPLKRAILPFGGIKMVKGSCDVYRRKLNPEVEKIFTEYRKTHNQGVF
DVYTPDILRCRKSGVITGLPDAYGRGRIIGDYRRLAVYGADFLMKDKQRQ
FASLQPNLEAGEDIQATIQLREEITEQFRALGQIKEMAASYGFDVSRPAE
NAQEAVQWTYFAYLAAVKSQNGAAMSFGRVSSFLDIYIERDLKAGKITEE
EAQELIDHLVMKLRMVRFLRTPEYDQLFSGDPMWATETLAGMGLDDRTLV
TKNSFRILNTLYTMGPSPEPNLTILWSEQLPEGFKRYCAKVSIDTSSVQY
ENDDLMRPDFDNDDYAIACCVSPMVIGKQMQFFGARANLAKTMLYAINGG
IDEKSGLQVGPKSTPITDEVLNFDDVMTRMDHFMDWLATQYVTALNIIHF
MHDKYSYEAALMAFHDRDVFRTMACGIAGLSVAADSLSAIKYAKVKPVRG
DIKDKDGNIVATNVALDFEIEGEYPQFGNNDSRVDDIACDLVERFMKKIQ
THKTYRNATPTQSVLTITSNVVYGKKTGNTPDGRRAGAPFGPGANPMHGR
DQKGAVASLTSVAKLPFAYAKDGISYTFSIVPNALGKDYEAQKRNLAGLM
DGYFHHETSVEGGQHLNVNVLNRETLLDAVEHPEKYPQLTIRVSGYAVRF
NALTKEQQMDVITRTFTESM$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTCAACTCGATGAAGCTCAACAAAAAGCCTGGGCAGGCTTTGTAGC
AGGCACATGGCAAACTGAAGTAAACGTACGTGATTTTATCCAAAAAAATT
ATACGCCATATGAAGGAGATGAATCTTTCCTAGCGGGAGCTACCCCCGCA
ACGACTAAACTATGGCAAGAGGTCATGGAAAAAATCAAAGTTGAGAATAA
AACGCACGAGCCTTATGATATTGACTGTGATATTCCGTCCACGATTACCT
CGCACAAACCGGGCTATATTGATCAATCCTTAGAAAAAATTGTTGGCCTT
CAAACAGATGCACCATTAAAACGAGCAATTCTTCCATTTGGTGGCATTAA
AATGGTAAAAGGCTCTTGTGATGTTTATCGCCGTAAACTTAATCCTGAAG
TTGAAAAAATCTTTACTGAATATCGTAAAACACATAACCAAGGCGTTTTT
GATGTTTATACGCCTGATATTTTACGTTGCCGTAAATCAGGCGTAATCAC
AGGTTTACCTGATGCCTATGGTCGTGGCCGTATTATTGGTGACTATCGCC
GTTTAGCCGTATATGGTGCAGACTTCTTAATGAAAGATAAACAGCGTCAA
TTTGCCTCATTACAGCCTAATTTAGAAGCAGGTGAAGACATTCAAGCAAC
CATTCAATTACGTGAAGAAATCACCGAACAATTCCGTGCTTTAGGACAAA
TCAAAGAAATGGCTGCCTCCTATGGCTTTGATGTTTCACGTCCCGCTGAA
AATGCACAAGAAGCAGTACAATGGACCTATTTTGCTTATTTAGCGGCAGT
TAAATCACAAAATGGCGCAGCAATGTCATTTGGGCGTGTTTCATCATTCT
TAGATATCTACATTGAACGTGATCTAAAAGCGGGCAAAATTACAGAAGAA
GAAGCACAAGAATTAATTGACCACTTAGTGATGAAATTACGGATGGTTCG
TTTCTTACGTACACCAGAATATGATCAATTATTCTCTGGCGATCCTATGT
GGGCGACTGAGACTTTAGCAGGAATGGGCTTAGATGACCGTACGTTGGTG
ACTAAAAACAGTTTCCGTATTCTGAACACACTCTATACAATGGGGCCTTC
ACCAGAGCCGAATTTAACGATCCTTTGGTCTGAACAATTACCAGAGGGTT
TCAAACGTTATTGTGCAAAAGTGTCTATTGATACATCATCAGTTCAATAT
GAAAATGATGATTTAATGCGCCCAGATTTCGATAATGATGACTATGCCAT
CGCGTGTTGTGTATCACCAATGGTGATCGGTAAACAAATGCAATTCTTCG
GGGCACGTGCAAACTTAGCCAAAACAATGTTATATGCAATCAATGGCGGT
ATTGACGAAAAATCAGGCTTACAAGTTGGTCCAAAATCAACACCTATTAC
CGATGAAGTATTAAACTTTGATGATGTAATGACACGTATGGATCACTTTA
TGGATTGGTTAGCCACACAATATGTGACCGCATTAAATATCATTCACTTT
ATGCACGATAAATACAGCTATGAAGCCGCATTAATGGCATTCCACGATCG
TGATGTATTCCGCACAATGGCGTGTGGTATTGCGGGCCTTTCTGTCGCAG
CAGACTCGTTATCTGCAATTAAATATGCCAAAGTAAAACCTGTACGTGGT
GATATCAAAGACAAAGATGGCAATATTGTCGCAACCAACGTGGCACTTGA
TTTTGAAATTGAAGGTGAATACCCACAATTCGGGAATAATGATAGTCGTG
TTGATGATATTGCGTGTGACTTAGTTGAACGCTTTATGAAAAAAATTCAA
ACACACAAAACATATCGCAATGCAACACCAACTCAATCAGTGTTAACAAT
TACATCTAACGTTGTATATGGTAAAAAAACCGGGAATACCCCCGATGGTC
GCCGTGCTGGAGCCCCATTTGGACCTGGCGCTAACCCGATGCATGGTCGT
GACCAAAAAGGTGCGGTAGCATCATTAACATCCGTTGCTAAACTTCCATT
TGCATACGCCAAAGATGGTATCTCATACACATTCTCAATTGTGCCTAATG
CCTTAGGTAAAGATTACGAAGCACAAAAACGTAACTTAGCAGGCCTAATG
GATGGTTATTTCCACCACGAAACAAGCGTTGAAGGTGGTCAGCATCTAAA
TGTCAATGTCCTAAATCGTGAAACATTATTAGATGCAGTGGAGCACCCAG
AAAAATATCCACAATTAACCATTCGTGTCTCTGGTTATGCTGTACGTTTT
AACGCTTTAACTAAAGAGCAACAAATGGACGTTATCACGCGTACATTTAC
AGAATCGATGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy