Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR713 IGR707 IGR706 IGR708 IGR705 IGR711 IGR709 IGR710 IGR712 HD0993 act, - HD0989 focA, - HD0991 potD, - HD0994 ftsY, - HD0984 prlC, - HD0988 pflB,pfl, - HD0990 HD0986 HD0992 hpaB, - HD0987 HD0985 HD0993 act, - HD0989 focA, - HD0991 potD, - HD0994 ftsY, - HD0984 prlC, - HD0988 pflB,pfl, - HD0990 HD0986 HD0992 hpaB, - HD0987 HD0985 act, - HD0989 focA, - HD0991 potD, - HD0994 ftsY, - HD0984 prlC, - HD0988 pflB,pfl, - HD0990 HD0993 HD0992 hpaB, - HD0987 HD0985 HD0986
* Calculated from Protein Sequence

Gene ID: HD0989

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
act  

Definition:
pyruvate formate-lyase activating enzyme

Gene Start:
784995

Gene Stop:
784261

Gene Length:
735

Molecular Weight*:
28027

pI*:
6.90

Net Charge*:
-0.63

EC:
2.3.1.54  

Functional Class:
Energy metabolism; Fermentation  

Pathway: pathway table
Butanoate metabolism
Pyruvate metabolism

Secondary Evidence:
Rodel,W., Plaga,W., Frank,R. and Knappe,J.
Primary structures of Escherichia coli pyruvate formate-lyase and
pyruvate-formate-lyase-activating enzyme deduced from the DNA
nucleotide sequences
Eur. J. Biochem. 177 (1), 153-158 (1988)
M:89030680

Walsby CJ, Ortillo D, Broderick WE, Broderick JB, Hoffman BM.An Anchoring Role for FeS Clusters: Chelation of the Amino Acid Moiety of S-Adenosylmethionine to the Unique Iron Site of the [4Fe-4S] Cluster of Pyruvate Formate-Lyase Activating Enzyme.
J Am Chem Soc. 2002 Sep 25;124(38):11270-1.
PMID: 12236732

Becker A, Kabsch W
X-ray Structure of Pyruvate Formate-Lyase in Complex with Pyruvate and CoA. HOW THE ENZYME USES THE CYS-418 THIYL RADICAL FOR
PYRUVATE CLEAVAGE.
J Biol Chem. 2002 Oct 18;277(42):40036-42.
PMID: 12163496


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to pyruvate formate-lyase activating enzyme; e.g. residues 3-244 are 77% similar to (U32703) pyruvate formate-lyase activating enzyme of Haemophilus influenzae, residues 1-244 are 69% similar to (X08035) pyruvate formate-lyase activating enzyme of Escherichia coli, residues 3-244 are 69% similar to (AF070944) pyruvate formate-lyase 1 activating enzyme of Pasteurella multocida.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1180
COG name: Pyruvate-formate lyase-activating enzyme
Functional Class:  O
The phylogenetic pattern of COG1180 is AMTk-qV-E-rH---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001989 (Radical activating enzymes) with a combined E-value of 8.1e-27.
    IPB001989A    15-42
    IPB001989B    72-83
    IPB001989C    126-131


ProDom Summary:  Protein Domain Search
Residues 47-173 are 29% similar to a (ACTIVATING ENZYME PYRUVATE IRON-SULFUR) protein domain (PD004351) which is seen in O68393_THAAR.

Residues 73-197 are 73% similar to a (COMPLETE PROTEOME COFACTOR BIOSYNTHESIS MOLYBDENUM) protein domain (PD000790) which is seen in PFLA_ECOLI.

Residues 3-41 are 84% similar to a (ACTIVATING ANAEROBIC REDUCTASE ENZYME) protein domain (PD016381) which is seen in Q9ZH78_PASMU.

Residues 198-244 are 74% similar to a (ENZYME ACTIVATING PYRUVATE LYASE) protein domain (PD266006) which is seen in PFLA_HAEIN.

Residues 3-41 are 71% similar to a (ENZYME ACTIVATING PYRUVATE IRON-SULFUR) protein domain (PD004758) which is seen in Q9X767_LISMO.

Residues 73-197 are 76% similar to a (ENZYME PYRUVATE ACTIVATING LYASE) protein domain (PD385927) which is seen in PFLA_HAEIN.

Residues 79-189 are 75% similar to a (PROTEOME COMPLETE PYRUVATE ACTIVATING) protein domain (PD385798) which is seen in Q9KQX8_VIBCH.



Paralogs:  Local Blast Search


HD0989 is paralogously related to HD0394 (7e-05).


Pfam Summary:  Pfam Search
Residues 23 to 186 (E-value = 1.1e-20) place HD0989 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSIARYHSYETCGTVDGPGIRFILFLQGCLMRCKYCHNRDTWDLEGGTKI
SVETLMKEVVSYKHFMKATGGGVTASGGEAILQMEFVRDWFRACKAEGIN
TCLDTNGFVRHYNAVVDEMLAVTDLVILDLKQLNDEIHQDLIGVSNKRTL
DFARYLHKIHKQTWIRYVVVPGYTDDDSAHKLGQFIQNMDNIEKVELLPY
HRLGAHKWKTLGYKYELEDVLPPSKEDLERLKAIIESYGHTVKY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTATAGCACGTTATCACTCTTATGAAACTTGTGGCACAGTAGACGG
CCCCGGCATTCGTTTTATTCTATTCTTGCAAGGCTGTTTAATGCGTTGTA
AATATTGCCATAACCGCGACACTTGGGATCTTGAAGGTGGCACCAAAATC
AGCGTTGAAACGTTAATGAAAGAAGTGGTCAGCTATAAGCATTTTATGAA
AGCGACAGGCGGTGGTGTAACTGCTTCAGGCGGTGAAGCCATTTTACAGA
TGGAATTTGTCCGTGATTGGTTTCGCGCTTGTAAAGCTGAAGGTATCAAT
ACTTGCTTAGACACCAATGGGTTTGTTCGCCATTATAATGCTGTTGTTGA
TGAAATGTTAGCCGTCACAGATTTAGTGATCTTAGATCTCAAACAACTCA
ATGATGAAATTCATCAAGACTTAATCGGTGTTTCAAACAAACGAACGCTT
GATTTCGCCCGCTATTTACATAAAATCCATAAACAAACATGGATTCGTTA
TGTGGTCGTACCAGGTTATACTGACGACGACTCTGCCCATAAGCTCGGAC
AATTTATTCAGAATATGGATAACATTGAAAAAGTTGAATTATTGCCTTAT
CACCGCTTAGGCGCACATAAATGGAAAACGTTAGGCTATAAATACGAATT
AGAAGACGTATTACCCCCCTCTAAAGAAGATTTAGAACGTTTGAAAGCAA
TTATTGAAAGTTACGGACATACTGTCAAATACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy