Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR703 IGR707 IGR706 IGR704 IGR708 IGR705 IGR711 IGR709 IGR710 fstE, - HD0982 act, - HD0989 focA, - HD0991 fstX, - HD0981 ftsY, - HD0984 prlC, - HD0988 pflB,pfl, - HD0990 HD0986 hpaB, - HD0987 HD0985 fstE, - HD0982 act, - HD0989 focA, - HD0991 fstX, - HD0981 ftsY, - HD0984 prlC, - HD0988 pflB,pfl, - HD0990 HD0986 hpaB, - HD0987 HD0985 act, - HD0989 focA, - HD0991 fstX, - HD0981 ftsY, - HD0984 prlC, - HD0988 pflB,pfl, - HD0990 fstE, - HD0982 hpaB, - HD0987 HD0985 HD0986
* Calculated from Protein Sequence

Gene ID: HD0988

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
prlC  

Definition:
oligopeptidase A

Gene Start:
784134

Gene Stop:
782104

Gene Length:
2031

Molecular Weight*:
77189

pI*:
5.50

Net Charge*:
-16.68

EC:
3.4.24.15  3.4.24.70  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Conlin,C.A., Trun,N.J., Silhavy,T.J. and Miller,C.G.
Escherichia coli prlC encodes an endopeptidase and is homologous to the Salmonella typhimurium opdA gene
J. Bacteriol. 174 (18), 5881-5887 (1992)
Medline: 92394891

Conlin,C.A. and Miller,C.G.
Location of the prlC (opdA) gene on the physical map of Escherichia coli
J. Bacteriol. 175 (17), 5731-5732 (1993)
Medline: 93374878


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to oligopeptidase A protein; e.g. residues 1-675 are 71% similar to (U32706) oligopeptidase A of Haemophilus influenzae, residues 1-675 are 63% similar to (AE000426) oligopeptidase A of Escherichia coli, residues 1-675 are 62% similar to (M84574) oligopeptidase A of Salmonella typhimurium.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0339
COG name: Zn-dependent oligopeptidases
Functional Class: E
The phylogenetic pattern of COG0339 is ----Y--cE--h---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0988 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 221 to 675 (E-value = 4.1e-214) place HD0988 in the Peptidase_M3 family which is described as Peptidase family M3 (PF01432)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSNPLLHYTGLPAFSKIKAEHIQPAVEAVIQQCRNVIETVAQIEHPTWEN
FYIPQAEVSDKFSRVWSPVGHLNGVKNSPELREAYQACLPLLSEYSTWAG
QHQGLYQGYLKLKNSPEFATYSIAQQKTIENTLRDFELSGISLPAEKQKR
YGEITSRLAELSSQFSNNVLDATMGWDILITDKAQLAGLPDSALEAAKLS
AESKNQTGYRFTLEFPSYYPVLTYCENRDLRAIIYKEYVTRASEQGENAG
KWDNSANMNEMLKLRLELAQLLGFTHYAELSLATKMAENPSQVVDFLTDL
AQRAKAQGEQELTELAEFVKKTYGITDLQAWDIPFYNEKQKQALYAINDE
ECRPYFPEDRVISGLFELMKRIFGLRIEEQFNIDVWHPDVRFFQIYDQHN
QERGSFYLDLYARENKRGGAWMDDCIGQKRRADGSLQKAVAYLTCNFNKP
IGNKPALFTHNEVTTLFHEFGHGIHHMLTEIDVADVAGINGVPWDAVELP
SQFLENWCWEEAALQFISGHYQTGEALPTEKLTQLLKAKNFQAAMFILRQ
LEFGLFDFRLHLAEPSDNIVLDMLKAVKTEVSVVKTPEWVRTPHSFSHIF
AGGYAAGYYSYLWAEVLSADAFAKFEEEGIFNRQTGQAYLDHILTRGGSE
EPMVLFERFRGRKPRLDALLRHKGIA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAACCCACTTTTACATTACACAGGTTTACCTGCCTTCTCAAAAAT
CAAAGCTGAACATATTCAACCTGCCGTTGAAGCCGTTATCCAACAATGTC
GTAACGTAATCGAAACAGTCGCTCAAATCGAACACCCCACTTGGGAAAAT
TTCTATATACCACAAGCAGAAGTCAGCGATAAATTTTCACGTGTTTGGTC
ACCGGTTGGCCACTTAAATGGCGTGAAAAACTCACCTGAATTACGCGAAG
CTTACCAAGCATGCTTACCATTACTCTCTGAGTACAGCACTTGGGCAGGA
CAACATCAAGGTTTATACCAAGGCTATCTCAAACTAAAAAACTCACCTGA
GTTCGCTACTTATTCAATTGCACAACAAAAAACCATCGAAAATACGCTAC
GCGATTTCGAACTTTCTGGCATCTCATTACCCGCTGAAAAACAAAAACGT
TATGGCGAAATCACCTCTCGTTTAGCAGAACTAAGCTCACAATTTAGCAA
TAACGTGCTAGATGCGACAATGGGATGGGATATCCTCATCACGGATAAAG
CACAATTAGCAGGCTTACCTGATTCCGCATTAGAAGCCGCTAAACTTTCC
GCCGAAAGTAAAAATCAAACAGGTTATCGCTTCACGCTTGAATTCCCTAG
TTATTATCCAGTATTAACTTATTGTGAGAATCGTGACTTACGCGCCATCA
TCTATAAAGAATATGTTACACGCGCTTCTGAACAAGGTGAAAATGCCGGT
AAATGGGATAACTCAGCCAATATGAATGAAATGCTCAAATTACGTCTAGA
GCTAGCACAACTATTAGGCTTTACTCATTATGCAGAGCTATCGCTTGCCA
CTAAAATGGCGGAAAATCCATCACAAGTGGTCGATTTTTTAACGGATCTT
GCTCAACGTGCCAAAGCACAAGGCGAACAAGAATTAACCGAATTGGCTGA
ATTTGTGAAGAAAACATACGGCATCACTGATCTCCAAGCTTGGGATATTC
CATTTTATAACGAAAAACAAAAACAAGCATTGTATGCCATTAATGATGAA
GAATGCCGTCCATATTTTCCAGAAGATCGCGTTATCTCCGGTTTATTCGA
ATTAATGAAACGTATTTTTGGCTTACGTATCGAAGAACAATTCAACATTG
ACGTATGGCACCCCGATGTACGTTTTTTCCAAATTTATGATCAACATAAC
CAAGAACGCGGATCGTTCTATCTAGATTTATATGCCCGTGAAAATAAACG
AGGCGGTGCTTGGATGGATGATTGTATTGGCCAAAAACGCCGTGCTGATG
GTTCATTACAAAAAGCGGTTGCTTATTTAACTTGTAATTTTAATAAACCC
ATCGGCAATAAACCGGCACTCTTTACTCACAATGAAGTAACCACGCTTTT
CCACGAATTTGGCCACGGCATTCATCATATGCTAACAGAAATTGACGTTG
CCGACGTTGCAGGCATCAACGGTGTCCCTTGGGACGCAGTAGAATTACCA
AGCCAATTCTTAGAAAATTGGTGCTGGGAAGAAGCCGCATTACAATTCAT
CTCAGGCCATTATCAGACAGGTGAAGCATTACCCACCGAAAAACTGACTC
AATTATTGAAAGCAAAAAACTTCCAAGCGGCTATGTTTATACTGCGTCAA
TTAGAATTTGGTTTATTCGATTTCCGCTTACATTTAGCTGAACCAAGCGA
CAATATCGTATTAGATATGCTAAAAGCGGTCAAAACCGAAGTCTCCGTAG
TTAAAACACCTGAATGGGTACGCACTCCTCACAGTTTTAGCCATATTTTT
GCAGGAGGCTATGCTGCAGGTTATTACAGCTATTTATGGGCAGAAGTGCT
TTCAGCCGATGCTTTTGCAAAATTTGAAGAAGAGGGTATTTTTAACCGCC
AAACAGGTCAAGCTTACTTAGATCATATTCTAACCCGCGGAGGCTCTGAA
GAACCTATGGTTTTATTTGAACGTTTCCGTGGCCGTAAACCACGTTTAGA
TGCTTTATTACGCCATAAAGGAATTGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy