Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR703 IGR704 IGR702 IGR700 IGR705 IGR701 IGR698 IGR699 HD0977 fstE, - HD0982 fstX, - HD0981 ftsY, - HD0984 mfd, - HD0975 folQ,folA, - HD0978 HD0985 cda,cdd, - HD0979 pepN, - HD0976 HD0977 fstE, - HD0982 fstX, - HD0981 ftsY, - HD0984 mfd, - HD0975 folQ,folA, - HD0978 HD0985 cda,cdd, - HD0979 pepN, - HD0976 HD0977 fstE, - HD0982 fstX, - HD0981 ftsY, - HD0984 mfd, - HD0975 folQ,folA, - HD0978 HD0985 cda,cdd, - HD0979 pepN, - HD0976
* Calculated from Protein Sequence

Gene ID: HD0978

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
folQ  folA  

Definition:
dihydroneopterin aldolase

Gene Start:
775886

Gene Stop:
776257

Gene Length:
372

Molecular Weight*:
14084

pI*:
6.00

Net Charge*:
-2.85

EC:
4.1.2.25  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Folate biosynthesis

Secondary Evidence:
Haussmann,C., Rohdich,F., Schmidt,E., Bacher,A. and Richter,G.
Biosynthesis of pteridines in Escherichia coli. Structural and
mechanistic similarity of dihydroneopterin-triphosphate epimerase
and dihydroneopterin aldolase
J. Biol. Chem. 273 (28), 17418-17424 (1998)
Medline: 98316300


Comment:
Belongs to the DHNA family. For other "fol" genes, see HD1108 (folD), HD1118 (folA), HD1465 (folC), HD0644 (folP).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to probable dihydroneopterin aldolase protein; e.g. residues 8-121 are 62% similar to (U32712) dihydroneopterin aldolase, putative of Haemophilus influenzae, residues 6-121 are 50% similar to [7428427] probable dihydroneopterin aldolase (EC 4.1.2.25) - Escherichia coli, residues 6-120 are 29% similar to [3023784] probable dihydroneopterin aldolase of Mycobacterium tuberculosis.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1539
COG name: Dihydroneopterin aldolase
Functional Class: H
The phylogenetic pattern of COG1539 is ----y--cEbrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003098 (Dihydroneopterin aldolase) with a combined E-value of 8.6e-30.
    IPB003098A    8-52
    IPB003098B    77-86
    IPB003098C    95-122


ProDom Summary:  Protein Domain Search
Residues 9-116 are 28% similar to a (TRIPHOSPHATE EPIMERASE) protein domain (PD338414) which is seen in Q9HYG7_PSEAE.

Residues 22-105 are 59% similar to a (DIHYDRONEOPTERIN ALDOLASE DHNA LYASE) protein domain (PD004848) which is seen in FOLB_HAEIN.

Residues 6-94 are 32% similar to a (DIHYDROPTEROATE DHPS SYNTHASE INCLUDES:) protein domain (PD212141) which is seen in FAS_YEAST.



Paralogs:  Local Blast Search

HD0978 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 122 (E-value = 5e-40) place HD0978 in the FolB family which is described as Dihydroneopterin aldolase (PF02152)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRKTKMADKVFIHELTAFAAIGAYDWEHTIKQRLVFNIEMAWDFTQAVMT
EDLQYCLNYAEISEKILHFVESKPFKLVETVAHQVADFLQENYAIQALRI
ELHKPKAVAQASSVGVIVERGAD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGAAAACTAAAATGGCGGATAAAGTTTTTATTCACGAATTGACCGC
ATTTGCGGCTATTGGCGCTTATGATTGGGAGCATACGATTAAACAACGTT
TAGTGTTTAATATCGAAATGGCATGGGATTTTACGCAAGCCGTGATGACG
GAAGATCTGCAATATTGCTTAAATTATGCAGAGATTTCAGAAAAAATATT
GCACTTTGTTGAATCAAAACCATTTAAATTAGTTGAAACGGTCGCACATC
AGGTAGCGGATTTTTTGCAAGAAAATTATGCAATTCAAGCGCTTAGAATT
GAATTGCATAAGCCAAAAGCAGTTGCTCAAGCAAGTAGTGTTGGTGTGAT
TGTGGAACGAGGTGCCGATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy