Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR703 IGR702 IGR700 IGR701 IGR698 IGR699 IGR697 HD0977 fstE, - HD0982 fstX, - HD0981 mfd, - HD0975 folQ,folA, - HD0978 cda,cdd, - HD0979 pepN, - HD0976 HD0977 fstE, - HD0982 fstX, - HD0981 mfd, - HD0975 folQ,folA, - HD0978 cda,cdd, - HD0979 pepN, - HD0976 HD0977 fstE, - HD0982 fstX, - HD0981 mfd, - HD0975 folQ,folA, - HD0978 cda,cdd, - HD0979 pepN, - HD0976
* Calculated from Protein Sequence

Gene ID: HD0976

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pepN  

Definition:
aminopeptidase N protein, pepN

Gene Start:
772507

Gene Stop:
775116

Gene Length:
2610

Molecular Weight*:
99871

pI*:
5.70

Net Charge*:
-14.76

EC:
3.4.11.2  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Glutathione metabolism

Secondary Evidence:
Foglino,M., Gharbi,S. and Lazdunski,A.
Nucleotide sequence of the pepN gene encoding aminopeptidase N of
Escherichia coli
Gene 49 (3), 303-309 (1986)
Medline: 87192020

McCaman,M.T. and Gabe,J.D.
The nucleotide sequence of the pepN gene and its over-expression in Escherichia coli
Gene 48 (1) , 145-153 (1986)
Medline: 87163509


Comment:
For other "pep" genes, see HD1832 (pepD), HD0555 (pepA), HD1169 (pepB).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to aminopeptidase N protein; e.g. residues 1-869 are 68% similar to (U32835) aminopeptidase N of Haemophilus influenzae, residues 2-868 are 60% similar to (AE000195) aminopeptidase N of Escherichia coli, residues 1-868 are 46% similar to (AL162756) aminopeptidase N of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0308
COG name: Aminopeptidase N
Functional Class: E
The phylogenetic pattern of COG0308 is ----Y--ce-rh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00756 (Membrane alanyl dipeptidase (M1) family signature) with a combined E-value of 1.3e-28.
    PR00756A    126-141
    PR00756B    176-191
    PR00756C    258-268
    PR00756D    294-309
    PR00756E    313-325


ProDom Summary:  Protein Domain Search
Residues 341-442 are 83% similar to a (AMINOPEPTIDASE HYDROLASE ZINC METALLOPROTEASE) protein domain (PD143214) which is seen in Q9CN28_PASMU.

Residues 440-868 are 60% similar to a (AMINOPEPTIDASE HYDROLASE PROTEOME) protein domain (PD043117) which is seen in AMPN_HAEIN.

Residues 1-255 are 70% similar to a (AMINOPEPTIDASE HYDROLASE PROTEOME) protein domain (PD262965) which is seen in Q9CN28_PASMU.

Residues 314-357 are 65% similar to a (AMINOPEPTIDASE HYDROLASE) protein domain (PD377538) which is seen in AMPN_CAUCR.

Residues 258-313 are 87% similar to a (AMINOPEPTIDASE HYDROLASE METALLOPROTEASE ZINC) protein domain (PD001134) which is seen in AMPN_HAEIN.



Paralogs:  Local Blast Search
HD0976 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 12 to 384 (E-value = 8.5e-80) place HD0976 in the Peptidase_M1 family which is described as Peptidase family M1 (PF01433)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQPKAKYRKDYHAPDFTITDIYLDFQLDSDRTFVISKLSVERKKAGATAL
RLDGHSFDFLSLKLNGEHYSAFVKDDQSLTIDVSAVADKFELEIETGLNP
AQNTSLQGLYQSSNAICTQCEAEGFRQITYMLDRPDVLAKYRTRITASKA
KYPILLSNGNRVAQGTLTDGRHWVEWQDPFLKPSYLFALVAGDFDLLQDT
FVTCSGRKVALEIYVDRGNLDRASWAMESLKRAMKWDETRFGLEYDLDIY
MIVAVDFFNMGAMENKGLNIFNAKFVLAKPETATDSDYLDIESVIGHEYF
HNWTGNRITCRDWFQLSLKEGLTVFRDQEFTADLWSRSAKRIDDVRLLRA
TQFAEDASPMAHPIRPEKVIEMNNFYTVTVYEKGAEVIRMLHTLLGEQLF
QQGMQLYVAENDGSAATCEDFIRAMERASSIDLSQFRRWYSQSGTPELTV
SDEYDEINHTYRLFVSQYTPATADQLEKLNLHIPLKIELYAQENGQAIPL
EFEGKAVHNVLDILQTHQTFEFDNVMYKPIPALLCDFSAPVKLDYNYTNQ
QLTALLKFAKNNFVRWNAAQTLFNNELRTNLVRHQTGQALSFSSELIEAL
IYVLDNAESDIQLTALMLNLPKSTEFAELFKVIDVTGIVIVRDFMLRTIA
ETLRDRFIHLYNRYRCDKYQVVASDMAKRALRNVCLTYLAFTEVGNHLTY
KHYQQSDNMTDTLAALSAATQAQLTCRDQLLADFEQKWQQDGLVMDKWFM
LQATRPDANVLQLVQSLLMHPSFNLNNPNRVRSLIGAFANQNPQAFHAVD
GSGYRFLVDILLKLNQHNPQLASRLIEPLIKLSRYDNQRQTLMKRGLKRL
MELDNLAPDLYEKIEKALQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACCTAAAGCAAAATATAGAAAAGATTACCACGCACCTGATTTTAC
TATTACTGATATTTATCTTGATTTTCAGCTTGATTCAGATCGTACTTTTG
TTATATCTAAATTAAGTGTAGAACGTAAAAAAGCAGGCGCAACGGCATTG
CGTTTAGATGGCCATAGCTTTGATTTTCTTTCCTTAAAGTTAAATGGCGA
GCATTATTCAGCATTCGTAAAAGATGATCAATCACTGACCATTGATGTGA
GCGCAGTGGCGGATAAGTTTGAGCTAGAAATTGAAACGGGCTTAAATCCC
GCCCAAAATACTTCCTTGCAGGGTTTATATCAATCAAGTAATGCGATTTG
TACGCAATGTGAAGCGGAAGGTTTTCGCCAAATTACCTATATGCTTGATC
GTCCAGATGTATTAGCAAAATATCGCACTAGAATCACCGCTTCTAAAGCA
AAATATCCTATTTTATTATCTAATGGGAACCGTGTTGCGCAAGGAACATT
AACCGATGGTCGTCATTGGGTAGAATGGCAAGATCCTTTTTTAAAACCAA
GTTATTTATTTGCTTTAGTGGCAGGCGACTTTGACTTGTTACAAGATACT
TTTGTCACCTGTAGTGGTCGCAAGGTGGCATTAGAAATTTATGTGGATCG
TGGCAATTTAGATCGAGCAAGTTGGGCGATGGAAAGTTTGAAGCGGGCAA
TGAAATGGGATGAAACACGCTTTGGACTTGAATATGATTTAGATATTTAT
ATGATCGTTGCGGTTGATTTCTTCAATATGGGGGCGATGGAAAATAAAGG
CTTAAATATTTTTAATGCTAAATTTGTATTAGCGAAGCCAGAGACCGCAA
CCGATAGCGATTATTTAGATATTGAAAGTGTGATTGGCCATGAATATTTC
CATAATTGGACCGGTAATCGTATTACTTGTCGTGATTGGTTTCAATTAAG
TTTAAAAGAAGGGCTCACCGTTTTTCGTGATCAAGAATTTACGGCAGACT
TATGGTCCCGCTCTGCAAAACGAATTGACGATGTTCGTTTATTACGTGCG
ACACAATTTGCTGAAGATGCCAGCCCAATGGCGCACCCTATTCGTCCTGA
AAAAGTGATTGAAATGAATAATTTTTATACCGTCACAGTGTATGAAAAAG
GTGCAGAAGTGATTCGTATGTTACATACTTTATTAGGTGAGCAACTGTTT
CAACAAGGAATGCAATTATATGTAGCAGAAAATGATGGTTCAGCAGCAAC
GTGTGAAGATTTTATCAGAGCAATGGAACGTGCTTCATCCATAGATTTAA
GCCAATTCCGCCGTTGGTATAGCCAATCAGGTACGCCAGAATTAACGGTG
AGTGATGAATATGATGAAATAAATCACACCTATCGTTTATTTGTTTCACA
GTATACGCCGGCAACGGCTGATCAATTAGAAAAACTTAACTTACATATTC
CTCTGAAAATTGAGTTGTATGCGCAAGAAAATGGCCAAGCTATTCCATTA
GAATTTGAAGGCAAGGCTGTTCATAATGTATTAGATATTTTACAAACGCA
TCAAACGTTTGAATTTGATAACGTGATGTATAAACCTATTCCGGCATTAT
TATGTGATTTCTCAGCGCCAGTGAAGTTAGATTATAACTATACTAATCAA
CAATTAACTGCATTACTGAAATTTGCTAAAAATAACTTTGTGCGTTGGAA
TGCAGCACAAACATTATTTAATAATGAATTACGTACTAATCTTGTACGCC
ATCAAACTGGGCAAGCATTATCATTTTCTAGCGAATTAATAGAAGCGCTA
ATTTATGTGTTAGATAATGCTGAAAGCGATATTCAGCTGACAGCCTTAAT
GCTTAACTTGCCAAAAAGCACAGAATTTGCTGAGTTATTTAAAGTGATTG
ATGTAACCGGCATTGTGATTGTTCGCGACTTTATGTTACGCACCATTGCG
GAAACATTACGAGACCGTTTTATTCATTTGTATAACCGTTACCGTTGTGA
CAAGTATCAAGTGGTAGCAAGCGATATGGCAAAACGCGCATTACGCAATG
TGTGTTTAACTTACTTAGCATTTACTGAAGTGGGCAATCATTTAACCTAT
AAACATTATCAACAATCGGATAATATGACGGACACGTTGGCGGCGCTTTC
AGCCGCGACACAAGCACAATTAACTTGTCGTGATCAACTGCTTGCTGATT
TTGAGCAAAAATGGCAACAAGATGGTTTAGTCATGGATAAATGGTTTATG
CTACAGGCGACGCGTCCTGATGCAAATGTATTACAGCTAGTGCAAAGTTT
ATTAATGCACCCAAGTTTTAACTTGAATAATCCAAATCGTGTGCGTTCGC
TAATAGGCGCATTCGCTAACCAAAATCCACAAGCTTTCCATGCGGTTGAT
GGTTCAGGCTACCGCTTTTTAGTTGATATATTGCTTAAATTAAATCAGCA
TAATCCACAGTTAGCATCACGTTTAATTGAACCTTTAATTAAATTATCTC
GCTATGATAATCAGCGCCAAACATTAATGAAACGAGGCTTAAAACGTTTG
ATGGAATTAGATAATTTAGCGCCAGATTTATACGAAAAGATCGAGAAAGC
GTTACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy