Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR679 IGR678 IGR686 IGR687 IGR690 IGR680 IGR684 IGR677 IGR683 IGR689 IGR682 IGR691 IGR685 IGR688 IGR681 HD0964 HD0948 HD0952 HD0958 HD0963 HD0947 HD0957 ssb, - HD0962 HD0951 HD0950 HD0960 HD0961 HD0966 topA, - HD0954 HD0965 HD0959 HD0953 HD0956 HD0964 HD0948 HD0952 HD0958 HD0963 HD0947 HD0957 ssb, - HD0962 HD0951 HD0950 HD0960 HD0961 HD0966 topA, - HD0954 HD0965 HD0959 HD0953 HD0956 HD0952 HD0963 HD0957 ssb, - HD0962 HD0950 HD0961 HD0966 topA, - HD0954 HD0955 HD0955 HD0964 HD0958 HD0947 HD0951 HD0960 HD0948 HD0965 HD0959 HD0953 HD0956
* Calculated from Protein Sequence

Gene ID: HD0956

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
757014

Gene Stop:
758003

Gene Length:
990

Molecular Weight*:
39567

pI*:
9.40

Net Charge*:
13.48

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 6-266 are 30% similar to 15597313 hypothetical protein
[Pseudomonas aeruginosa PA01]. Residues 3-314 are 28% similar to 23470322 hypothetical protein [Pseudomonas syringae pv. syringae B728a].

No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-266 are 29% similar to a (PROTEOME COMPLETE PA2117) protein domain (PD319882) which is seen in Q9I1Z8_PSEAE.



Paralogs:  Local Blast Search
HD0956 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSIHEAYCVQLERVVSITEARTEFLSRSPCKRFDFLCSTESCRQRGVKII
GINYDHFPDEIRQSPHFKYRTTNNRLHSPECQWCQTITERLVGESEEEYK
IRKMRSRLHDFIDEFQLPEDEFELSERTKKTATKTASKREQRDASSTIKT
TQQQKRYIITNQLMRLVEVYLDARRNLPEKDFLALPLKVTNSSVKFLYQY
FRRAENAIKDKHKCVCIGEVEFFDRAELLYFKLRKPYQEDKSAPPIPICL
GIRKSILETYRYRRMLRSHIDSNPYEHKYFKVYFIPNENDFNLKTVKNKE
GKETDIYFFEIDDLNLFCLFNYSYLKKKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTATACACGAGGCTTACTGTGTTCAACTAGAAAGGGTTGTATCAAT
CACAGAGGCGAGAACTGAATTTTTAAGTCGTTCTCCTTGTAAGCGATTTG
ATTTTTTATGTTCAACCGAGTCATGTCGACAAAGAGGCGTCAAAATTATT
GGAATAAATTATGATCATTTTCCTGATGAAATAAGGCAATCACCGCACTT
TAAATATAGAACCACTAACAACCGGCTTCATTCTCCGGAATGTCAGTGGT
GTCAAACAATCACAGAACGGTTAGTAGGCGAATCGGAAGAAGAATACAAG
ATAAGAAAAATGCGGAGTCGTTTACATGATTTCATAGATGAGTTTCAGTT
GCCTGAAGATGAATTTGAACTGTCTGAACGTACTAAAAAAACTGCGACAA
AGACTGCCTCGAAGCGAGAACAAAGAGACGCATCATCTACCATTAAAACG
ACTCAACAGCAAAAGCGGTATATTATAACCAATCAGTTAATGAGACTGGT
TGAAGTATATTTAGATGCGAGAAGAAACCTACCTGAAAAAGATTTTCTAG
CACTGCCGCTAAAAGTGACCAACTCAAGTGTGAAATTTCTGTATCAGTAT
TTTCGTAGGGCAGAAAATGCAATTAAGGATAAACATAAATGTGTTTGTAT
TGGCGAGGTGGAGTTTTTTGACCGAGCGGAGTTGTTGTATTTTAAATTAC
GAAAACCTTATCAAGAAGATAAAAGTGCGCCACCAATTCCTATTTGTTTA
GGCATTAGAAAATCGATTTTAGAGACATATCGTTATAGACGAATGTTACG
CTCACATATTGACAGTAATCCATACGAACATAAATATTTCAAAGTCTATT
TTATTCCTAATGAAAATGATTTTAACCTCAAGACAGTAAAAAATAAGGAA
GGAAAAGAGACTGATATCTACTTTTTTGAGATAGACGATCTCAACTTGTT
CTGTTTATTTAACTACAGTTATTTAAAAAAGAAAAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy