Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR679 IGR678 IGR686 IGR675 IGR687 IGR690 IGR680 IGR684 IGR677 IGR683 IGR689 IGR682 IGR691 IGR676 IGR685 IGR688 IGR681 HD0964 HD0948 HD0952 HD0958 HD0963 HD0947 HD0946 HD0957 ssb, - HD0962 HD0951 HD0950 radC, - HD0945 HD0960 HD0961 topA, - HD0954 HD0965 HD0959 HD0953 HD0956 HD0964 HD0948 HD0952 HD0958 HD0963 HD0947 HD0946 HD0957 ssb, - HD0962 HD0951 HD0950 radC, - HD0945 HD0960 HD0961 topA, - HD0954 HD0965 HD0959 HD0953 HD0956 HD0952 HD0963 HD0947 HD0957 ssb, - HD0962 HD0950 radC, - HD0945 HD0961 topA, - HD0954 HD0955 HD0955 HD0964 HD0948 HD0958 HD0946 HD0951 HD0960 HD0965 HD0959 HD0953 HD0956
* Calculated from Protein Sequence

Gene ID: HD0955

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
756884

Gene Stop:
756687

Gene Length:
198

Molecular Weight*:
7671

pI*:
9.10

Net Charge*:
1.47

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No strong hits using gapped BLAST however one borderline hit to a repressor from V. cholerae (6409126): residues 1-60 are 41% similar to this sequence.

No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0955 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MPTKHIETELWQQVEAKTVETIIQSKVMIKETDILQEIIKKGLEHITVEE
LKRYALQRKKDGNKQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAACTAAACACATTGAAACTGAACTCTGGCAGCAGGTCGAGGCAAA
AACGGTTGAAACAATTATTCAAAGCAAAGTGATGATTAAAGAAACCGATA
TTTTGCAAGAAATTATCAAGAAAGGGTTGGAACATATTACCGTAGAGGAA
TTAAAACGGTATGCTCTCCAGCGAAAAAAAGATGGGAATAAGCAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy