Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR666 IGR662 IGR665 IGR661 IGR657 IGR658 IGR664 IGR663 IGR660 IGR659 HD0927 HD0918 HD0919 HD0926 HD0931 HD0928 HD0917 HD0933 HD0920 HD0923 HD0924 HD0921 HD0922 HD0927 HD0918 HD0919 HD0926 HD0931 HD0928 HD0917 HD0933 HD0920 HD0923 HD0924 HD0921 HD0922 HD0926 HD0928 HD0917 HD0933 HD0930 HD0932 HD0931 HD0927 HD0919 HD0930 HD0932 HD0918 HD0920 HD0921 HD0922 HD0925 HD0924 HD0925 HD0923
* Calculated from Protein Sequence

Gene ID: HD0923

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
738478

Gene Stop:
738825

Gene Length:
348

Molecular Weight*:
12746

pI*:
6.10

Net Charge*:
-2.14

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 18-99 are 33% similar to residues 44-129 of 17547291, a probable lipoprotein [Ralstonia solanacearum].

No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0923 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MMMKKLVTITLMLGVSMATYAAPIMTQDEAHKVVEASIYKNKLTKLSKDC
IKYGMSEEAGEYLVDIYEVHNKKCGGDPSVQNRLFSYSVDKKSGALATDA
MHDGVDWDGDLHPIQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGATGAAAAAATTAGTAACAATCACCTTAATGTTGGGAGTGAGTAT
GGCGACCTACGCCGCACCAATCATGACACAGGATGAAGCGCATAAGGTCG
TAGAAGCGTCCATTTATAAGAATAAATTAACCAAACTCAGTAAAGATTGC
ATTAAATATGGTATGAGTGAAGAAGCCGGTGAATATTTGGTCGATATTTA
TGAGGTGCATAATAAAAAATGCGGGGGTGATCCTTCCGTTCAAAACCGCC
TATTTAGTTATAGTGTAGATAAGAAAAGCGGTGCATTAGCAACAGACGCC
ATGCATGACGGCGTTGATTGGGACGGTGACTTACATCCTATTCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy