Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR651 IGR652 IGR650 IGR661 IGR657 IGR656 IGR658 IGR655 IGR654 IGR660 IGR653 IGR649 IGR659 HD0911 HD0918 HD0919 HD0909 hicB, - HD0910 HD0907 HD0914 HD0915 HD0913 HD0917 HD0920 HD0912 HD0908 HD0921 HD0922 HD0911 HD0918 HD0919 HD0909 hicB, - HD0910 HD0907 HD0914 HD0915 HD0913 HD0917 HD0920 HD0912 HD0908 HD0921 HD0922 HD0919 hicB, - HD0910 HD0907 HD0914 HD0915 HD0913 HD0917 HD0911 HD0918 HD0909 HD0920 HD0912 HD0908 HD0922 HD0921
* Calculated from Protein Sequence

Gene ID: HD0914

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
possible type I restriction enzyme M protein

Gene Start:
732061

Gene Stop:
731303

Gene Length:
759

Molecular Weight*:
29162

pI*:
5.50

Net Charge*:
-8.54

EC:
 

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 8-213 are 34% similar to residues 430-634 of >16763059 hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi].

HD0914 is weakly similar to a type I restriction enzyme M protein from U. urealyticum (UU098; score: 43, E value: 7e-05). No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0286
COG name: Type I restriction-modification system methyltransferase subunit
Functional Class:  L
The phylogenetic pattern of COG0286 is -Mt-----e-rhUJ-p-----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** PR00507 (N12 class N6 adenine-specific DNA methyltransferase signature) with a combined E-value of 2.6e-09.
    PR00507A    102-118
    PR00507B    134-148
    PR00507C    232-244


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0914 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTSYEKEFTTLFSKIAPHFRRSELFYDFITIFGLEFYLAIYSKHANEQLV
KRYQTAVSHYTAKEKQQLSQLFVIIINALEQKTYDFLGTVFMALDLSDGY
KGQYFTPPHIAQAMAAMTLMDCHSIIEKRGFMKLQEPTCGSGVMIIGSYN
HLRQEHFNPQQQLWVRAQDLDFTTAMMCYIQMTLLHIPGEVIIGNTLTDE
VCYHLYTPAHILGNGTMRLNNMTESEVEAQHNTDTVNNPPFEIDWETEAV
FY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAGTTACGAAAAAGAATTTACAACACTGTTCAGTAAAATTGCACC
GCACTTTCGCCGCTCAGAGCTTTTCTATGACTTTATTACTATTTTTGGCT
TGGAGTTTTACTTAGCCATTTATAGTAAGCATGCCAATGAACAGCTAGTA
AAACGTTATCAAACTGCGGTGAGTCATTACACTGCGAAAGAGAAGCAACA
ACTAAGCCAGCTCTTCGTCATTATCATTAATGCACTGGAGCAGAAAACGT
ATGATTTTCTCGGTACCGTATTTATGGCGCTGGACTTGAGTGATGGTTAC
AAAGGGCAATATTTTACACCGCCACATATCGCTCAGGCGATGGCAGCCAT
GACGTTAATGGACTGTCACAGCATTATTGAGAAACGTGGATTTATGAAAT
TACAAGAACCGACCTGCGGTTCAGGTGTAATGATTATCGGAAGCTATAAT
CATCTACGACAAGAGCATTTCAATCCACAACAGCAATTGTGGGTAAGAGC
GCAAGACTTGGATTTCACGACAGCAATGATGTGTTATATACAGATGACTC
TTTTACATATTCCCGGCGAAGTTATTATTGGTAATACATTAACCGATGAG
GTGTGCTATCACTTGTATACGCCTGCGCACATACTCGGTAACGGGACGAT
GAGGTTGAATAATATGACTGAGAGCGAGGTAGAGGCTCAGCATAATACTG
ATACAGTTAATAACCCACCATTCGAGATCGACTGGGAAACTGAAGCAGTG
TTTTATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy