Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR651 IGR652 IGR645 IGR650 IGR654 IGR648 IGR647 IGR643 IGR646 IGR653 IGR649 IGR644 HD0911 HD0909 hicB, - HD0910 HD0907 HD0900 HD0914 HD0913 HD0906 HD0901 istB, - HD0905 HD0912 HD0908 cdtA, - HD0902 cdtB, - HD0903 HD0911 HD0909 hicB, - HD0910 HD0907 HD0900 HD0914 HD0913 HD0906 HD0901 istB, - HD0905 HD0912 HD0908 cdtA, - HD0902 cdtB, - HD0903 hicB, - HD0910 HD0907 HD0900 HD0914 HD0913 HD0911 HD0909 HD0901 istB, - HD0905 HD0912 HD0908 cdtA, - HD0902 cdtB, - HD0903 cdtC, - HD0904 cdtC, - HD0904 HD0906
* Calculated from Protein Sequence

Gene ID: HD0907

DNA Molecule Name:
1  

Genomic Island ID:
2

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
727119

Gene Stop:
726538

Gene Length:
582

Molecular Weight*:
22572

pI*:
10.10

Net Charge*:
7.83

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits using gapped BLAST, except a few hits to hypothetical proteins. For example, residues 95-178 of HD0907 are 41% similar to residues 14-93 of a hypothetical protein from Acinetobacter sp. SUN (4581938). See also gi 10957032.

No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 95-178 are 41% similar to a (PLASMID) protein domain (PD284137) which is seen in Q9X2K1_BBBBB.



Paralogs:  Local Blast Search
HD0907 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MYLWNIQISSAFLEVISLYEVTLRNTLVKALEPNYRQYSILNDNFIRALR
HETREALIVAVNKVSLNSHKYSAVRGAHGMIQPLKIDPRDVPVGKVVAEL
NFVFWENMLSKTHSSRWKAHYKEAFPNLVVEPNIGIECQIARIHQITGKV
RELRNRICHHEPIFDENKINLSELYTQIKEVLNYISRLDKYTK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATCTTTGGAATATCCAGATTAGTTCAGCTTTTTTAGAAGTTATTAG
CCTGTATGAGGTTACATTAAGAAACACTCTAGTAAAAGCTTTAGAACCTA
ATTATAGACAATATAGCATTCTTAATGACAACTTTATTCGAGCGTTACGC
CATGAAACAAGAGAAGCATTAATTGTTGCGGTCAATAAAGTATCACTAAA
TTCCCACAAATACTCTGCGGTCCGTGGTGCTCATGGAATGATACAGCCGT
TAAAAATAGATCCCAGAGATGTACCTGTAGGGAAGGTTGTTGCAGAGTTA
AACTTCGTATTTTGGGAAAATATGCTTTCAAAAACTCACAGTAGTCGTTG
GAAAGCTCATTACAAAGAGGCGTTTCCTAATCTAGTCGTTGAACCTAATA
TAGGTATAGAGTGCCAAATAGCACGCATTCATCAAATAACAGGTAAAGTA
AGGGAATTAAGAAATAGAATTTGCCACCACGAACCTATATTTGATGAAAA
TAAAATTAATTTAAGTGAGTTATATACGCAGATAAAAGAAGTTCTTAACT
ATATATCTCGACTTGATAAATATACTAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy