Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR642 IGR651 IGR652 IGR645 IGR650 IGR641 IGR648 IGR647 IGR643 IGR646 IGR653 IGR649 IGR644 HD0911 HD0909 HD0899 hicB, - HD0910 HD0907 HD0900 HD0898 HD0913 HD0906 HD0901 istB, - HD0905 HD0912 HD0908 cdtA, - HD0902 cdtB, - HD0903 HD0911 HD0909 HD0899 hicB, - HD0910 HD0907 HD0900 HD0898 HD0913 HD0906 HD0901 istB, - HD0905 HD0912 HD0908 cdtA, - HD0902 cdtB, - HD0903 hicB, - HD0910 HD0907 HD0898 HD0913 HD0911 HD0909 HD0900 HD0899 HD0901 istB, - HD0905 HD0912 HD0908 cdtA, - HD0902 cdtB, - HD0903 cdtC, - HD0904 cdtC, - HD0904 HD0906
* Calculated from Protein Sequence

Gene ID: HD0905

DNA Molecule Name:
1  

Genomic Island ID:
2

Genbank ID:
0

Gene Name:
istB  

Definition:
IstB C-terminal homolog

Gene Start:
725681

Gene Stop:
726007

Gene Length:
327

Molecular Weight*:
12630

pI*:
6.50

Net Charge*:
-1.62

EC:
 

Functional Class:
Unassigned  

Pathway: pathway table

Secondary Evidence:
Ogawa,N. and Miyashita,K.
The chlorocatechol-catabolic transposon Tn5707 of Alcaligenes eutrophus NH9, carrying a gene cluster highly homologous to that in the 1,2,4-trichlorobenzene-degrading bacterium Pseudomonas sp. strain P51, confers the ability to grow on 3-chlorobenzoate.
Appl. Environ. Microbiol. 65(2): 724-731,1999.
Medline: 99124613.

Yeo,C.C. and Poh,C.L.
Characterization of IS1474, an insertion sequence of the IS21 family isolated from Pseudomonas alcaligenes NCIB 9867.
FEMS Microbiol. Lett. 149(2): 257-263,1997.
Medline: 97286520.

Reimmann,C., Moore,R., Little,S., Savioz,A., Willetts,N.S. and Haas,D.
Genetic structure, function and regulation of the transposable element IS21.
Mol. Gen. Genet. 215(3): 416-424,1989.
Medline: 89218951.



Comment:


Blast Summary:  PSI-Blast Search
Three very significant hits using gapped BLAST; two hits to IstB sequences from insertion sequence IS1326 (1022913) and Ralstonia eutropha (1805362); one hit to a hypothetical protein from Pseudomonas alcaligenes (7515344). Other weaker but still significant hits to probable transposases from the Y. pestis plasmid pMT1 (7443685 & 7443684), insertion sequences from Streptomyces coelicolor (7480906) and E. coli (124937), among others.

No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-95 are 58% similar to a (REPLICATION ATP-BINDING DNA-BINDING INITIATOR) protein domain (PD066439) which is seen in P95537_ALCEU.



Paralogs:  Local Blast Search
HD0905 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 95 (E-value = 4.6e-09) place HD0905 in the IstB family which is described as IstB-like ATP binding protein (PF01695)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VLDLVNQLELDSQMKQFKLVSQMTRQDVIILDEPGYLPFSQKRGALLFHL
MSQLHENTSVIITTNLEFSEWGTLFTEAKMTNALLDRLIHHCHMLETGNE
SYRFKHRN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTGGACTTGGTGAATCAACTGGAATTGGACAGTCAAATGAAGCAATT
TAAGCTTGTTTCTCAAATGACTCGTCAGGATGTCATTATTCTAGATGAGC
CGGGCTATTTACCTTTTAGTCAAAAAAGGGGAGCTTTGCTATTTCATCTG
ATGAGTCAACTTCACGAAAATACAAGTGTGATTATTACCACGAACCTTGA
GTTTTCGGAGTGGGGGACCTTGTTTACCGAGGCTAAAATGACAAATGCAC
TATTAGATAGGTTGATTCACCATTGTCACATGTTAGAAACAGGTAACGAA
TCTTACCGTTTTAAACATCGTAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy