Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-2 IGR642 IGR636 IGR640 IGR641 IGR637 IGR635 IGR638 IGR643 IGR644 IGR639 HD0899 HD0900 HD0898 HD0897 cysK, - HD0896 rho, - HD0895 HD0901 cdtA, - HD0902 argC, - HD0890 argD, - HD0892 HD0899 HD0900 HD0898 HD0897 cysK, - HD0896 rho, - HD0895 HD0901 cdtA, - HD0902 argC, - HD0890 argD, - HD0892 Type: tandem, Name:  - 13 Type: tandem, Name:  - 14 HD0900 HD0898 HD0897 cysK, - HD0896 rho, - HD0895 HD0899 HD0901 cdtA, - HD0902 argC, - HD0890 argD, - HD0892 argB, - HD0891 argB, - HD0891
* Calculated from Protein Sequence

Gene ID: HD0896

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cysK  

Definition:
cysteine synthase (O-acetylserine sulfhydrylase)

Gene Start:
718727

Gene Stop:
717777

Gene Length:
951

Molecular Weight*:
33921

pI*:
7.00

Net Charge*:
0.00

EC:
4.2.99.8  

Functional Class:
Amino acid biosynthesis; Glycine-serine family  

Pathway: pathway table
Cysteine metabolism
Selenoamino acid metabolism
Sulfur metabolism

Secondary Evidence:
Byrne,C.R., Monroe,R.S., Ward,K.A. and Kredich,N.M.
DNA sequences of the cysK regions of Salmonella typhimurium and Escherichia coli and linkage of the cysK regions to ptsH.
J. Bacteriol. 170(7): 3150-3157,1988.
Medline: 88257033.

Fernandez M, Kleerebezem M, Kuipers OP, Siezen RJ, van Kranenburg R.
Regulation of the metC-cysK operon, involved in sulfur metabolism in Lactococcus lactis.
J Bacteriol. 2002 Jan;184(1):82-90.
PMID: 11741847


Comment:
For other "cys" genes, see HD1030 (cysB), HD1093 (cysS), HD0659 (cysE), HD0832 (cysZ), HD0840 (cysQ).

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to cysteine synthases from H. influenzae (1169185), E. coli (1799833 & 118143), S. typhimurium (6980381), among many others.

No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0031
COG name: Cysteine synthase/cystathionine beta-synthase
Functional Class:  E
The phylogenetic pattern of COG0031 is ----YqvCEBRhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001216 (Cysteine synthase/cystathionine beta-synthase P-phosphate attachment site) with a combined E-value of 2.3e-137.
    IPB001216A    11-20
    IPB001216B    28-72
    IPB001216C    77-126
    IPB001216D    139-179
    IPB001216E    221-275
    IPB001216F    279-308
***** IPB001926 (Pyridoxal-5'-phosphate-dependent enzymes, beta family) with a combined E-value of 6.5e-17.
    IPB001926A    65-92
    IPB001926B    146-154


ProDom Summary:  Protein Domain Search
Residues 187-311 are 76% similar to a (CYSTEINE SYNTHASE O-ACETYLSERINE LYASE SULFHYDRYLASE) protein domain (PD001075) which is seen in Q9CKD0_PASMU.

Residues 191-270 are 40% similar to a (CYSTEINE O-ACETYLSERINE PYRIDOXAL LYASE) protein domain (PD088402) which is seen in CYSK_FLASP.

Residues 103-146 are 59% similar to a (CYSTEINE SYNTHASE O-ACETYLSERINE LYASE) protein domain (PD334247) which is seen in SRPG_SYNP7.

Residues 113-168 are 51% similar to a (LYASE CYSTEINE SYNTHASE) protein domain (PD385055) which is seen in Q9SXS7_ARATH.

Residues 1-107 are 89% similar to a (SYNTHASE LYASE CYSTEINE PYRIDOXAL PHOSPHATE BIOSYNTHESIS) protein domain (PD000323) which is seen in Q9CKD0_PASMU.



Paralogs:  Local Blast Search
HD0896 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 301 (E-value = 1.3e-119) place HD0896 in the PALP family which is described as Pyridoxal-phosphate dependent enzyme (PF00291)

PDB Hit:
pdb|1FCJ|A Chain A, Crystal Structure Of Oass Complexed With Ch... 383 1e-107
pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-A... 381 6e-107

Gene Protein Sequence:
MTIFADNSYTIGNTPIVRLKHFGQNGNLLVKIEARNPSFSVKCRIGANMV
WQAEKDGILTKDKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSDER
KRLLRGLGANLVLTESTLGMKGAIAKAEEIFASDPNRYIMLKQFENPANP
AIHQQTTGPEIWQATEGKIDVIVAGVGTGGTITGVSRYIKQDKGKQIISV
AVEPKESPVITQTLNGEEVQPGPHKIQGIGAGFIPKNLDLTLIDRVEQVS
SEEALKIAHQLMAKEGILVGISSGAAVAAADRLAKLPEFADKQIVAVLPS
ASERYLSTLLFEGIEI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAATTTTCGCAGATAATTCATATACCATTGGCAATACCCCCATTGT
GCGTTTAAAACATTTTGGTCAAAATGGCAATTTACTAGTGAAAATTGAAG
CCCGTAATCCAAGCTTTAGTGTTAAATGTCGTATTGGTGCCAATATGGTA
TGGCAAGCGGAAAAAGACGGTATTCTAACTAAAGATAAAGAAATTGTGGA
TGCAACAAGCGGCAATACAGGCATTGCGTTAGCCTATGTTGCGGCAGCTC
GTGGCTATAAAATCACCTTAACAATGCCAGAAACCATGAGCGATGAACGT
AAACGTCTATTACGTGGCTTAGGCGCAAATTTAGTGCTTACTGAAAGCAC
ATTAGGTATGAAAGGCGCTATTGCTAAAGCTGAAGAGATTTTCGCTAGCG
ATCCAAACCGTTACATAATGCTAAAACAGTTTGAAAATCCAGCAAATCCA
GCCATTCACCAACAAACGACAGGTCCTGAGATTTGGCAGGCGACTGAAGG
CAAAATTGATGTTATCGTAGCAGGCGTAGGCACTGGCGGTACAATCACAG
GCGTTTCACGCTATATAAAACAAGACAAAGGCAAACAAATTATCTCTGTT
GCAGTGGAACCAAAAGAATCCCCGGTAATAACACAAACATTAAATGGCGA
GGAAGTGCAACCTGGTCCACATAAAATTCAAGGTATTGGTGCGGGCTTTA
TTCCTAAAAACTTAGATTTAACGTTAATTGACCGCGTTGAACAAGTATCG
AGCGAAGAAGCCCTTAAAATAGCACATCAACTTATGGCTAAAGAAGGTAT
TCTAGTCGGCATTTCATCTGGTGCCGCAGTCGCAGCAGCAGATCGTTTAG
CTAAATTACCTGAATTTGCGGATAAACAAATTGTGGCAGTCTTACCTTCT
GCATCAGAACGTTACTTAAGTACCTTATTATTTGAAGGAATTGAAATTTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy