Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-2 IGR636 IGR640 IGR634 IGR637 IGR635 IGR633 IGR638 IGR639 HD0898 HD0897 cysK, - HD0896 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 argC, - HD0890 argD, - HD0892 HD0887 HD0898 HD0897 cysK, - HD0896 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 argC, - HD0890 argD, - HD0892 HD0887 Type: tandem, Name:  - 13 Type: tandem, Name:  - 14 HD0898 HD0897 cysK, - HD0896 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 argC, - HD0890 argD, - HD0892 HD0887 argB, - HD0891 argB, - HD0891
* Calculated from Protein Sequence

Gene ID: HD0892

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
argD  

Definition:
acetylornithine aminotransferase, argD

Gene Start:
715068

Gene Stop:
716252

Gene Length:
1185

Molecular Weight*:
42866

pI*:
6.60

Net Charge*:
-2.39

EC:
2.6.1.11  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Urea cycle and metabolism of amino groups

Primary Evidence:
NULL

Secondary Evidence:
Heimberg H, Boyen A, Crabeel M, Glansdorff N.
Escherichia coli and Saccharomyces cerevisiae acetylornithine aminotransferase: evolutionary relationship with ornithine aminotransferase.
Gene. 1990 May 31;90(1):69-78.
PMID: 2199330

Comment:
For other "arg" genes, see HD1033 (argH), HD1204 (argG), HD1384 (argA), HD0262 (argR), HD0890 (argC), HD0891 (argB).

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to acetylornithine aminotransferases from Methanococcus jannaschii (2833557), Methanobacterium thermoautotrophicum (3913079), Arabidopsis thaliana (6730727), among others.

HD0892 is similar to a predicted adenosylmethionine-8-amino-7-oxononanoate aminotransferase from C. pneumoniae (CPn1041). HD0892 is less similar to predicted glutamate-1-semialdehyde 2,1-aminomutases from C. pneumoniae (CPn0138) and C. trachomatis (CT210). No similarity to sequences from M. genitalium, M. pneumoniae, U. urealyticum, or T. pallidum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0160
COG name: PLP-dependent aminotransferases
Functional Class: E
The phylogenetic pattern of COG0160 is AmtKYqvcEBRh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000954 (Aminotransferase class-III pyridoxal-phosphate) with a combined E-value of 2.9e-48.
    IPB000954A    36-65
    IPB000954B    196-235
    IPB000954C    244-259
    IPB000954D    280-298


ProDom Summary:  Protein Domain Search
Residues 155-288 are 30% similar to a (FISSION YEAST) protein domain (PD200245) which is seen in P78766_SCHPO.

Residues 192-250 are 54% similar to a (AMINOTRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD000465) which is seen in LAT_STRCL.

Residues 87-288 are 53% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL COMPLETE PROTEOME) protein domain (PD000087) which is seen in ARGD_METJA.

Residues 232-288 are 68% similar to a (AMINOTRANSFERASE COMPLETE PROTEOME) protein domain (PD249119) which is seen in Q9PDF2_XYLFA.

Residues 100-150 are 49% similar to a (AMINOTRANSFERASE PYRIDOXAL PHOSPHATE COMPLETE PROTEOME) protein domain (PD186083) which is seen in P78766_SCHPO.



Paralogs:  Local Blast Search
HD0892 is paralogously related to HD0729 (2e-35) and HD1685 (1e-32).


Pfam Summary:  Pfam Search
Residues 13 to 394 (E-value = 2e-140) place HD0892 in the Aminotran_3 family which is described as Aminotransferase class-III (PF00202)

PDB Hit:
pdb|1GBN|A Chain A, Human Ornithine Aminotransferase Complexed ... 217 1e-057
pdb|2OAT|A Chain A, Ornithine Aminotransferase Complexed With 5... 217 1e-057
pdb|1QJ3|A Chain A, Crystal Structure Of 7,8-Diaminopelargonic ... 147 2e-036

Gene Protein Sequence:
MMTSDQIKQLDANYIAQTYAKFDLALSHGQGCEVWDFDGNKYLDFTSGIG
VNSLGWADPDWLEAVIAQLHKLSHTSNLFYTEPSARLAKHLVQVSGLKRV
FFANSGAEANEGAIKVARKYSHDKYGDTRSTIISLVNSFHGRTISTLAAT
GQKLFHQHFFPFTAGFEHLIANDLNAFKTRIAQNDICAIILEVVQGEGGV
CSLDQAYLQAVQGLCQVQDILLIIDEVQTGIGRTGTMFAYQQFELKPDIV
TLAKGLAGGLPIGAFLLADKVAETLAKGDHGSTFGANPVSCAAANAVLTK
LEPLFLTEVMRKGQKLRKALQSLPHVKSISGLGLMIGVEFDEHINVADVV
TNCLKQGVLFLTAKTKLRMLPPLIINDEQLERGVTVLAQVLSEM$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGACAAGCGATCAGATTAAACAGTTAGATGCCAACTATATCGCACA
AACCTATGCTAAATTTGATTTAGCACTTTCACACGGCCAAGGCTGTGAAG
TGTGGGATTTTGACGGTAATAAGTATTTAGATTTCACGAGTGGCATTGGT
GTTAATAGTTTAGGATGGGCAGATCCAGATTGGCTAGAGGCTGTGATTGC
ACAATTACATAAGTTATCACATACCTCAAACCTATTTTATACTGAACCAT
CAGCCCGACTAGCGAAGCATTTAGTTCAAGTAAGCGGGCTAAAACGGGTT
TTTTTTGCTAATTCTGGTGCAGAAGCGAATGAGGGTGCGATTAAAGTTGC
GCGTAAATATAGCCACGACAAATATGGTGATACACGTTCTACTATTATTA
GCTTAGTTAATTCTTTCCATGGACGGACCATTTCAACGTTAGCCGCAACC
GGTCAAAAATTATTTCATCAACATTTTTTCCCATTTACGGCAGGTTTTGA
ACACTTAATCGCGAACGATCTTAATGCATTTAAAACACGGATAGCACAAA
ATGATATTTGTGCAATTATCTTAGAAGTAGTGCAAGGAGAGGGCGGGGTT
TGTTCACTTGATCAAGCCTATTTACAAGCAGTGCAAGGTTTATGCCAAGT
ACAAGATATTTTACTAATTATTGATGAAGTGCAAACCGGTATAGGTCGCA
CGGGCACAATGTTTGCTTATCAACAATTTGAGTTAAAACCTGATATAGTG
ACTTTAGCAAAGGGGTTAGCCGGTGGTTTACCAATAGGTGCTTTTCTATT
AGCAGATAAAGTCGCTGAGACTCTTGCTAAAGGCGATCACGGTTCAACTT
TTGGTGCTAATCCCGTTAGCTGTGCGGCGGCTAATGCCGTGTTAACTAAA
CTAGAACCGCTATTTTTAACAGAAGTGATGCGCAAAGGGCAGAAGTTACG
CAAGGCCTTACAGTCATTACCGCATGTTAAATCAATTTCCGGATTAGGTT
TAATGATCGGTGTTGAATTTGATGAACACATTAACGTCGCTGATGTTGTC
ACCAATTGCCTGAAACAAGGAGTCCTTTTTCTGACCGCTAAAACTAAATT
AAGAATGTTGCCGCCATTAATTATTAATGATGAACAACTTGAACGAGGTG
TGACAGTATTAGCCCAAGTACTTAGCGAAATGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy