Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-2 IGR636 IGR634 IGR637 IGR635 IGR633 IGR638 IGR632 IGR639 HD0897 cysK, - HD0896 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 argC, - HD0890 argD, - HD0892 HD0887 HD0897 cysK, - HD0896 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 argC, - HD0890 argD, - HD0892 HD0887 HD0897 cysK, - HD0896 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 argC, - HD0890 argD, - HD0892 HD0887 argB, - HD0891 argB, - HD0891
* Calculated from Protein Sequence

Gene ID: HD0891

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
argB  

Definition:
acetylglutamate kinase

Gene Start:
714217

Gene Stop:
715071

Gene Length:
855

Molecular Weight*:
30374

pI*:
5.80

Net Charge*:
-2.51

EC:
2.7.2.8  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Urea cycle and metabolism of amino groups

Secondary Evidence:
Fernandez-Murga ML, Ramon-Maiques S, Gil-Ortiz F, Fita I, Rubio V.
Towards structural understanding of feedback control of arginine biosynthesis: cloning and expression of the gene for the
arginine-inhibited N-acetyl-L-glutamate kinase from Pseudomonas aeruginosa, purification and crystallization of the recombinant
enzyme and preliminary X-ray studies.
Acta Crystallogr D Biol Crystallogr. 2002 Jun;58(Pt 6 Pt 2):1045-7.
PMID: 12037312

Ramon-Maiques S, Marina A, Gil-Ortiz F, Fita I, Rubio V.
Structure of acetylglutamate kinase, a key enzyme for arginine biosynthesis and a prototype for the amino acid kinase enzyme family, during catalysis.
Structure (Camb). 2002 Mar;10(3):329-42.
PMID: 12005432

Comment:
For other "arg" genes, see HD1033 (argH), HD1204 (argG), HD1384 (argA), HD0262 (argR), HD0890 (argC), HD0892 (argD).

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to probable acetylglutamate kinases from Synechocystis PCC6803 (7387549), Arabidopsis thaliana (6706427), Methanobacterium thermoautotrophicum (7387541), among others. Residues 18-283 are 44$ similar to 22095462 ARGB_THETN Acetylglutamate kinase (NAG kinase) (AGK) (N-acetyl-L-glutamate
5-phosphotransferase).

No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0548
COG name: Acetylglutamate kinase
Functional Class: E
The phylogenetic pattern of COG0548 is amtkyqvcEbr----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001057 (Glutamate 5-kinase) with a combined E-value of 7.2e-15.
    IPB001057A    41-66
    IPB001057C    177-210
    IPB001057D    227-259


ProDom Summary:  Protein Domain Search
Residues 24-262 are 42% similar to a (KINASE ACETYLGLUTAMATE TRANSFERASE NAG) protein domain (PD003894) which is seen in ARGB_PORPU.



Paralogs:  Local Blast Search
HD0891 is paralogously related to HD1384 (3e-17).


Pfam Summary:  Pfam Search
Residues 24 to 259 (E-value = 4.1e-46) place HD0891 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNQTTTFDKLCNYSAACLANWQGKTIVVKYGGNAMISAELKQTVMQNILL
LNQYGINVVLVHGGGPEISLGMKLLGKEPQFINGLRVTDQDTIDVVLQML
AGKVNKRLVALLKGKGIGLCGIDGGLIQCEKLEAELDYGLVGNIVQVDIT
VLQMALAANLIPVIAAVAVDQQGIIYNVNADTVASEIAVALGADKLVLMT
DIAGLLADRNDERSLMSRVEVSQVETLIAQGIISDGMIPKVASCTRFINA
GGIEAHIIDGRIKHAILLSILSDKQNGTRFYKEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCAAACAACTACATTTGACAAGTTATGTAATTATTCGGCCGCTTG
TTTAGCCAACTGGCAAGGAAAAACCATCGTTGTAAAATATGGTGGTAATG
CAATGATCAGTGCAGAATTGAAACAGACTGTGATGCAGAATATTTTGTTA
TTGAATCAGTATGGTATAAACGTTGTATTAGTTCACGGTGGCGGGCCTGA
AATTTCATTGGGCATGAAATTGTTAGGCAAAGAACCACAATTTATTAATG
GGTTACGCGTTACGGATCAAGATACAATCGATGTTGTGTTACAAATGTTA
GCAGGTAAAGTAAATAAACGATTAGTTGCATTGTTGAAAGGAAAAGGAAT
CGGGCTTTGTGGGATTGATGGCGGTTTAATTCAATGTGAAAAATTGGAAG
CAGAGCTTGATTATGGTTTAGTTGGCAATATTGTGCAAGTAGATATAACC
GTATTGCAAATGGCATTAGCGGCTAATTTAATCCCAGTGATTGCAGCAGT
CGCAGTTGATCAGCAAGGCATAATTTATAATGTTAATGCAGATACTGTAG
CCAGCGAGATTGCGGTGGCACTAGGCGCGGATAAGTTAGTGTTAATGACC
GATATTGCAGGTTTATTGGCAGATCGGAATGATGAACGTAGCTTGATGAG
TCGCGTAGAGGTTAGTCAAGTAGAAACACTTATTGCACAAGGTATTATCA
GCGATGGAATGATTCCTAAAGTAGCTAGCTGTACAAGGTTCATCAATGCG
GGCGGTATTGAAGCTCATATTATTGATGGACGTATTAAGCACGCTATTTT
GCTTTCAATATTAAGCGATAAGCAAAATGGTACGCGTTTTTATAAGGAAA
AATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy