Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR636 IGR634 IGR637 IGR635 IGR633 IGR638 IGR632 IGR639 cysK, - HD0896 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 HD0885 argC, - HD0890 argD, - HD0892 HD0887 cysK, - HD0896 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 HD0885 argC, - HD0890 argD, - HD0892 HD0887 cysK, - HD0896 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0885 argC, - HD0890 argD, - HD0892 HD0887 argB, - HD0891 argB, - HD0891 HD0886
* Calculated from Protein Sequence

Gene ID: HD0890

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
argC  

Definition:
N-acetyl-gamma-glutamyl-phosphate reductase

Gene Start:
713263

Gene Stop:
714207

Gene Length:
945

Molecular Weight*:
34037

pI*:
6.70

Net Charge*:
-1.88

EC:
1.2.1.38  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Urea cycle and metabolism of amino groups

Secondary Evidence:
Sakanyan,V., Petrosyan,P., Lecocq,M., Boyen,A., Legrain,C., Demarez,M., Hallet,J.N. and Glansdorff,N. 1996. Genes and enzymes of the acetyl cycle of arginine biosynthesis in Corynebacterium glutamicum: enzyme evolution in the early steps of the arginine pathway. Microbiology 142(Pt 1): 99-108. Medline: 96146054.

Floriano,B., Herrero,A. and Flores,E. 1994. Analysis of expression of the argC and argD genes in the cyanobacterium Anabaena sp. strain PCC 7120. J. Bacteriol. 176(20): 6397-6401. Medline: 95014086.

Floriano,B., Herrero,A. and Flores,E. 1992. Isolation of arginine auxotrophs, cloning by mutant complementation, and sequence analysis of the argC gene from the cyanobacterium Anabaena species PCC 7120. Mol. Microbiol. 6(15): 2085-2094. Medline: 93023834.

Comment:
For other "arg" genes, see HD1033 (argH), HD1204 (argG), HD1384 (argA), HD0262 (argR), HD0892 (argD), HD0891 (argB).

Blast Summary:  PSI-Blast Search
Two significant hits using gapped BLAST to N-acetyl-gamma-glutamyl-phosphate reductases from Anabaena PCC7120 (1703381) and Deinococcus radiodurans (7473183). One less significant hit to a N-acetyl-gamma-glutamyl-phosphate reductase from Corynebacterium glutamicum (8039776).

No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0002
COG name: Acetylglutamate semialdehyde dehydrogenase
Functional Class: E
The phylogenetic pattern of COG0002 is amtkyqvcebr----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000706 (N-acetyl-gamma-glutamyl-phosphate reductase, active site) with a combined E-value of 1e-22.
    IPB000706A    9-30
    IPB000706E    110-127
    IPB000706F    143-155
    IPB000706G    174-185
    IPB000706H    197-211
    IPB000706I    279-312
***** IPB000534 (Semialdehyde dehydrogenase) with a combined E-value of 1.1e-09.
    IPB000534A    110-127
    IPB000534B    286-298


ProDom Summary:  Protein Domain Search
Residues 1-100 are 49% similar to a (N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE DEHYDROGENASE) protein domain (PD119144) which is seen in Q9RY72_DEIRA.

Residues 104-305 are 39% similar to a (DEHYDROGENASE REDUCTASE) protein domain (PD003765) which is seen in ARGC_ANASP.



Paralogs:  Local Blast Search
HD0890 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSKYKIFVDGAVGTTGLGIFERLRAAKDIELLTLADEQRKDLKARLANVA
AADLTLLCLPDTASKQLVLHAPPSAKICDTSTAHRVDPAWVYGFAELSGQ
FNNIQTATRVAIPGCHATGYIALLRPLIERHYLNADYPFTCHSLTGYSGG
GKAMIADYQAPIRDDKFKAPRMYGLTLHHKHLAEMCAFTGSSNPPIFTPI
VADYYSGMLVNVPLPLAAFTQEANDGEKISGILADYYREASLINVHYVND
LPTDGMVAANSLAGKDRLDIFVYANQTQVVLSAIFDNLGKGASGAAIQCM
NIMLGRDQLADLHI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAAATATAAAATTTTTGTTGATGGAGCCGTTGGCACAACAGGATT
AGGTATTTTTGAACGACTTCGTGCGGCTAAAGATATCGAACTGTTAACTT
TAGCCGATGAACAGCGGAAAGATTTAAAGGCTCGTTTAGCGAATGTTGCA
GCTGCCGATTTAACTTTACTTTGCTTGCCTGATACTGCTTCTAAACAATT
AGTGTTACATGCACCGCCTAGTGCTAAAATTTGTGATACTTCAACAGCAC
ATCGTGTTGATCCGGCATGGGTATATGGTTTTGCTGAATTAAGCGGTCAA
TTTAATAATATTCAAACCGCAACGCGAGTTGCCATACCAGGTTGCCATGC
TACAGGCTATATTGCATTGCTCCGACCATTGATTGAAAGGCATTATTTAA
ATGCAGATTACCCTTTTACGTGTCATTCTTTAACCGGTTATTCCGGTGGC
GGGAAAGCGATGATTGCAGATTATCAAGCTCCTATTAGAGATGATAAGTT
TAAGGCGCCTAGAATGTATGGATTAACATTACACCATAAACACCTTGCTG
AAATGTGTGCTTTTACTGGTTCGTCAAACCCTCCGATTTTCACGCCAATT
GTTGCTGATTATTACAGCGGTATGTTAGTTAATGTACCGCTTCCTCTTGC
CGCTTTTACTCAAGAGGCGAATGATGGCGAAAAAATTTCTGGTATATTAG
CAGACTATTATCGTGAGGCTAGCTTGATTAATGTTCATTATGTTAATGAT
CTGCCAACAGATGGCATGGTCGCGGCGAATAGCTTAGCGGGTAAAGATCG
TTTAGATATTTTTGTATATGCTAATCAAACACAAGTCGTATTATCAGCTA
TTTTTGATAACTTGGGGAAAGGGGCTTCTGGTGCGGCTATTCAATGTATG
AACATTATGTTAGGTCGTGATCAACTTGCAGATTTACATATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy