Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR636 IGR631 IGR634 IGR637 IGR635 IGR633 IGR638 IGR632 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 HD0885 argC, - HD0890 HD0884 argD, - HD0892 HD0887 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 HD0885 argC, - HD0890 HD0884 argD, - HD0892 HD0887 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 argC, - HD0890 HD0884 argD, - HD0892 HD0887 argB, - HD0891 argB, - HD0891 HD0885
* Calculated from Protein Sequence

Gene ID: HD0889

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
deoD  

Definition:
purine nucleoside phosphorylase

Gene Start:
712407

Gene Stop:
713123

Gene Length:
717

Molecular Weight*:
25959

pI*:
5.20

Net Charge*:
-4.46

EC:
2.4.2.1  2.7.-.-  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nicotinate and nicotinamide metabolism
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Larsen,J.E., Albrechtsen,B. and Valentin-Hansen,P.
Analysis of the terminator region after the deoCABD operon of Escherichia coli K-12 using a new class of single copy number operon-fusion vectors.
Nucleic Acids Res. 15(13): 5125-5140, 1987.
Medline: 87259990.

Sukhodolets VV, Trenina MA.
[Study of RecA-independent homologous recombination and a chromosomal rearrangement in the Escherichia coli strain carrying an extended tandem duplication]
Genetika. 2002 Feb;38(2):171-81. Russian.
PMID: 11898608

Lee J, Filosa S, Bonvin J, Guyon S, Aponte RA, Turnbull JL.
Expression, purification, and characterization of recombinant purine nucleoside phosphorylase from Escherichia coli.
Protein Expr Purif. 2001 Jul;22(2):180-8.
PMID: 11437593


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to purine nucleoside phosphorylases from Actinobacillus pleuropneumoniae (3121993), H. influenzae (1169271), E. coli (1633413 & 118446), among others.

HD0889 is similar to predicted purine nucleoside phosphorylases from T. pallidum (TP0734 & TP0170), M. genitalium (MG049), U. urealyticum (UU281), and M. pneumoniae (MP0092). It is also similar to a uridine phosphorylase from T. pallidum (TP1027). No similarity to sequences from C. trachomatis and C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0813
COG name: Purine-nucleoside (and uridine) phosphorylase
Functional Class:  F
The phylogenetic pattern of COG0813 is --------Eb-HUJgp-L---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000845 (Purine and other phosphorylases, family 1) with a combined E-value of 3.5e-65.
    IPB000845A    19-30
    IPB000845B    43-77
    IPB000845C    150-160
    IPB000845D    174-210


ProDom Summary:  Protein Domain Search
Residues 35-105 are 83% similar to a (PHOSPHORYLASE NUCLEOSIDASE COMPLETE PROTEOME) protein domain (PD003928) which is seen in Q9CLE6_PASMU.

Residues 1-34 are 97% similar to a (PHOSPHORYLASE PURINE NUCLEOSIDE) protein domain (PD411638) which is seen in Q9CLE6_PASMU.

Residues 111-233 are 84% similar to a (PHOSPHORYLASE NUCLEOSIDE PURINE) protein domain (PD414982) which is seen in DEOD_ACTPL.



Paralogs:  Local Blast Search

HD0889 is paralogously related to HD1898 (4e-05).


Pfam Summary:  Pfam Search
Residues 14 to 232 (E-value = 1.1e-103) place HD0889 in the PNP_UDP_1 family which is described as Phosphorylase family (PF01048)

PDB Hit:
pdb|1ECP|A Chain A, Purine Nucleoside Phosphorylase >gi|1633414... 369 2e-103

Gene Protein Sequence:
MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAEQVTNVRNMFGYTG
TYKGRRISIMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVRADVKL
RDIVIGSGACTDSKVNRIRFRDNDFAAIADFEMTLAAYQVAKQKNISVQV
GNLFSADLFYTPDVAMFDVMEKYGILGVEMEAAGIYVVAAEYGVKSLAIC
TVSDHIRSGEKLSAEDRQLTFNEMIEIALESVLIGDQT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCCACATATTAACGCACCTGCAGGTGCATTCGCTGATGTTGTATT
GATGCCCGGTGATCCACTTCGTGCAAAATACATTGCTGAAACTTTTTTAG
AAAATGCTGAGCAAGTTACTAATGTTCGCAATATGTTTGGTTATACAGGC
ACTTACAAAGGTCGTCGTATTTCAATAATGGGACACGGAATGGGGATTCC
ATCTTGCTCCATTTATGCCAAAGAGTTAATTACTGAATACGGTGTCAAAA
AAATTATCCGAGTAGGTTCTTGTGGTGCAGTGCGTGCGGATGTAAAACTA
CGTGATATTGTGATCGGCAGTGGTGCTTGTACTGATTCAAAAGTCAACCG
TATTCGTTTTCGCGATAATGATTTTGCTGCAATTGCTGATTTTGAAATGA
CATTAGCCGCGTATCAAGTGGCTAAACAAAAAAATATTTCAGTGCAAGTA
GGCAATTTATTCTCAGCAGATTTATTTTATACGCCTGATGTTGCAATGTT
TGATGTAATGGAAAAATATGGCATTTTAGGGGTTGAAATGGAAGCGGCTG
GTATTTATGTCGTTGCTGCAGAATACGGTGTGAAATCATTAGCTATTTGT
ACGGTTTCTGATCATATTCGTAGTGGTGAGAAATTAAGCGCAGAAGATCG
TCAGTTAACCTTTAATGAGATGATTGAAATTGCGTTAGAATCAGTATTAA
TCGGTGATCAAACCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy