Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR636 IGR631 IGR634 IGR637 IGR635 IGR633 IGR632 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 HD0885 argC, - HD0890 argD, - HD0892 HD0884 HD0887 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 HD0885 argC, - HD0890 argD, - HD0892 HD0884 HD0887 rho, - HD0895 deoD, - HD0889 deoC, - HD0888 HD0886 HD0885 argC, - HD0890 argD, - HD0892 HD0884 HD0887 lsg-4, - HD0883 argB, - HD0891 argB, - HD0891 lsg-4, - HD0883
* Calculated from Protein Sequence

Gene ID: HD0888

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
deoC  

Definition:
deoxyribose-phosphate aldolase

Gene Start:
711555

Gene Stop:
712331

Gene Length:
777

Molecular Weight*:
27497

pI*:
5.20

Net Charge*:
-3.70

EC:
4.1.2.4  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Pentose phosphate cycle

Primary Evidence:
NULL

Secondary Evidence:
Valentin-Hansen,P., Boetius,F., Hammer-Jespersen,K. and Svendsen,I.
The primary structure of Escherichia coli K12 2-deoxyribose
5-phosphate aldolase. Nucleotide sequence of the deoC gene and the
amino acid sequence of the enzyme
Eur. J. Biochem. 125 (3), 561-566 (1982)
M:83003651


Valentin-Hansen P, Hammer-Jespersen K, Boetius F, Svendsen I.
Structure and function of the intercistronic regulatory deoC-deoA element of Escherichia coli K-12.
EMBO J. 1984 Jan;3(1):179-83.
PMID: 6323164


Comment:
0

Blast Summary:  PSI-Blast Search
Two significant hits using gapped BLAST to deoxyribose phosphate aldolases from E. coli (729314 & 41252). Numerous less significant hits to deoxyribose phosphate aldolases too numerous to mention.

HD0888 is similar to predicted deoxyribose phosphate aldolases from U. urealyticum (UU585), T. palldium (TP0264), M. pneumoniae (MP0091), and M. genitalium (MG050). No similarity to sequences from C. trachomatis or C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0274
COG name: Deoxyribose-phosphate aldolase
Functional Class:  F
The phylogenetic pattern of COG0274 is --t--qvcebrh--gp-l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002915 (Deoxyribose-phosphate aldolase) with a combined E-value of 2.1e-24.
    IPB002915A    15-35
    IPB002915B    70-103
    IPB002915C    199-225


ProDom Summary:  Protein Domain Search
Residues 59-226 are 74% similar to a (DEOXYRIBOSE-PHOSPHATE ALDOLASE LYASE) protein domain (PD005801) which is seen in DEOC_ECOLI.

Residues 14-57 are 70% similar to a (BASE DEOXYRIBOSE-PHOSPHATE SCHIFF LYASE) protein domain (PD348482) which is seen in DEOC_ECOLI.



Paralogs:  Local Blast Search

HD0888 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 232 (E-value = 9.7e-83) place HD0888 in the DeoC family which is described as Deoxyribose-phosphate aldolase (PF01791)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSLKSSAKVALSLMDLTTLNDNATDEKVIALCQQGNTEFGTPAAVCVYPR
FVPVARKALKAQQTEQVKIATVTNFPHGNDDIDIAVTETKAAIAYGADEV
DVVFPYKALMAGNEQVGFELVKQCKAVCQASGVLLKVIIETGELKTPALI
RKASELAIQAGADFIKTSTGKVAINATLESARIMLETIRDLNVAEKVGFK
AAGGVKTTEEAEQYLALAKTILGEDWVNSAHFRFGASSLLNNLLATLNDQ
TAQVVTGY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTTAAAAAGTTCAGCGAAAGTGGCATTATCATTAATGGATTTAAC
CACTCTTAATGATAACGCTACCGATGAAAAAGTGATTGCACTTTGCCAAC
AAGGCAACACGGAATTTGGTACCCCTGCGGCTGTTTGTGTTTATCCTCGA
TTTGTACCGGTAGCACGTAAAGCCTTAAAGGCGCAACAGACAGAACAGGT
GAAAATTGCAACTGTAACTAATTTCCCTCATGGTAATGATGATATTGATA
TTGCCGTTACTGAAACAAAAGCTGCCATTGCTTATGGTGCGGATGAAGTC
GATGTGGTTTTCCCTTATAAAGCGTTAATGGCGGGTAATGAGCAAGTTGG
TTTTGAATTAGTCAAACAATGTAAGGCAGTTTGCCAAGCCAGTGGAGTAT
TACTGAAAGTAATTATTGAAACCGGTGAATTAAAAACACCAGCCTTAATT
CGCAAAGCAAGTGAGCTTGCTATTCAAGCTGGTGCAGATTTTATTAAAAC
TTCAACAGGCAAAGTTGCCATTAATGCCACTTTAGAATCTGCTCGTATTA
TGTTAGAAACTATTCGTGATTTAAATGTGGCAGAAAAAGTCGGCTTTAAA
GCCGCAGGCGGTGTAAAAACTACAGAAGAAGCCGAGCAATATTTAGCATT
AGCTAAAACGATTCTAGGTGAAGATTGGGTGAATAGTGCGCATTTCCGTT
TTGGTGCATCGAGTTTACTTAATAATCTATTGGCCACATTAAACGATCAA
ACCGCACAAGTAGTGACAGGTTATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy