Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR631 IGR628 IGR630 IGR634 IGR629 IGR627 IGR633 IGR632 HD0881 sppA, - HD0878 HD0879 deoD, - HD0889 deoC, - HD0888 HD0886 HD0880 HD0885 HD0884 lsg-1, - HD0882 HD0887 HD0881 sppA, - HD0878 HD0879 deoD, - HD0889 deoC, - HD0888 HD0886 HD0880 HD0885 HD0884 lsg-1, - HD0882 HD0887 HD0881 sppA, - HD0878 HD0879 deoD, - HD0889 deoC, - HD0888 HD0886 HD0880 HD0885 HD0884 lsg-1, - HD0882 HD0887 lsg-4, - HD0883 lsg-4, - HD0883
* Calculated from Protein Sequence

Gene ID: HD0884

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein (part of lsg locus ?)

Gene Start:
706955

Gene Stop:
708139

Gene Length:
1185

Molecular Weight*:
45212

pI*:
9.90

Net Charge*:
8.34

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Secondary Evidence:
Yoshida,Y., Nakano,Y., Suzuki,N., Nakao,H., Yamashita,Y. and Koga,T.
Genetic analysis of the gene cluster responsible for synthesis of serotype e-specific polysaccharide antigen in Actinobacillus actinomycetemcomitans.
Biochim. Biophys. Acta 1489: 457-461,1999.
Medline: 10673051.

Yoshida,Y., Nakano,Y., Yamashita,Y. and Koga,T.
Identification of a genetic locus essential for serotype b-specific antigen synthesis in Actinobacillus actinomycetemcomitans.
Infect. Immun. 66(1): 107-114, 1998.
Medline: 98084462.

Comment:


Blast Summary:  PSI-Blast Search
Residues 2-387 are 61% similar to 15602375 unknown from Pasteurella multocida.

Three significant hits using gapped BLAST to hypothetical/unnamed proteins from Actinobacillus actinomycetemcomitans (1944155, 7467537, & 5545313).

HD0884 is similar to a hypothetical protein from U. urealyticum (UU579). No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, or T. pallidum.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-387 are 54% similar to a (COMPLETE PROTEOME SYNTHESIS FOR) protein domain (PD042278) which is seen in Q9CNC2_PASMU.



Paralogs:  Local Blast Search
HD0884 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MISAVINLFYIYDPWIMHVIRMAFIVGGVSVLFLAYQWYRRKITDIAFPL
DSVLVILALIILSAIPLFVHGTQDISVLLMYVKSLILFIFGIAIYNVFYR
MNNQANQAKLVDDLKIGVLIQAIMGVLALTGISIFIDMALGTNANYFLPR
FQGSEQEYRLYNITSSAFFQLSAFYLVLLHFLLAYNAKHNSIPTIFIFLM
LFIGLISGRTFFVFSLFSVLFYFKWRYCNYVLLFILAVVSFAYFLPENKY
VGHALEPVVNLFSQKIQEFSSSTTNLVQNHLFIPNLKQLMIGDGYYFTED
GRYYGGSDSGFIRQALYGGMGYILLCFLFTVYFVKRVADNWFEGSWKFII
STVGLLSILNIKADIYAYPGIMFVLLMFLSLFGNKGKIITLFNR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCAGTGCGGTAATTAATTTATTTTATATTTATGATCCTTGGATTAT
GCATGTTATTCGTATGGCATTTATTGTCGGTGGGGTGTCGGTGCTATTCT
TGGCTTATCAATGGTATCGTCGCAAAATTACCGATATCGCTTTTCCATTA
GACAGTGTGTTGGTAATTTTGGCACTGATTATTTTATCGGCTATTCCATT
ATTCGTGCACGGTACGCAAGATATTTCAGTGTTATTAATGTATGTAAAAT
CATTGATTTTATTTATATTTGGTATTGCAATTTATAATGTATTTTATCGA
ATGAATAACCAAGCCAATCAAGCTAAGCTAGTAGATGATTTGAAAATAGG
CGTATTGATTCAGGCGATAATGGGCGTGTTAGCATTAACCGGGATCAGTA
TTTTTATTGATATGGCATTAGGCACTAACGCCAACTATTTTTTGCCACGT
TTTCAAGGATCTGAACAAGAATACCGTTTATATAACATTACTTCTTCAGC
GTTCTTTCAATTGAGTGCTTTTTATTTAGTCTTATTGCATTTCCTGCTCG
CATATAATGCAAAACATAATAGTATTCCGACTATTTTTATTTTTCTAATG
CTGTTTATTGGGTTAATTTCAGGCAGAACATTTTTTGTCTTTTCTTTATT
CAGTGTCTTATTTTACTTTAAATGGCGTTATTGCAATTATGTGTTACTTT
TTATTTTAGCTGTTGTGAGTTTTGCTTATTTTTTACCAGAAAATAAGTAT
GTCGGACACGCTTTAGAACCGGTTGTTAATTTATTCTCACAAAAAATTCA
AGAATTTAGTTCTTCCACGACTAATTTAGTCCAAAATCATTTATTTATAC
CTAATCTAAAACAATTAATGATTGGTGATGGGTATTATTTTACTGAAGAT
GGCCGTTATTATGGCGGTTCGGATTCCGGTTTTATTCGTCAAGCATTATA
TGGTGGTATGGGGTATATTTTACTTTGTTTTTTATTTACGGTTTATTTTG
TGAAACGGGTCGCGGATAATTGGTTTGAAGGCAGTTGGAAATTTATTATT
TCTACCGTTGGACTATTAAGCATTTTAAATATTAAAGCTGATATTTATGC
TTATCCGGGTATTATGTTTGTATTGTTAATGTTTTTATCTTTATTTGGGA
ATAAAGGTAAAATAATTACGTTATTCAACCGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy