Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR631 IGR628 IGR630 IGR626 IGR625 IGR629 IGR627 HD0881 HD0876 ndh, - HD0874 sppA, - HD0878 HD0879 HD0880 HD0885 HD0884 lsg-1, - HD0882 HD0881 HD0876 ndh, - HD0874 sppA, - HD0878 HD0879 HD0880 HD0885 HD0884 lsg-1, - HD0882 HD0881 HD0876 ndh, - HD0874 sppA, - HD0878 HD0877 sprT, - HD0875 sprT, - HD0875 HD0877 HD0879 HD0880 HD0885 HD0884 lsg-1, - HD0882 lsg-4, - HD0883 lsg-4, - HD0883
* Calculated from Protein Sequence

Gene ID: HD0880

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
possible dehydrogenase

Gene Start:
703257

Gene Stop:
704081

Gene Length:
825

Molecular Weight*:
30671

pI*:
8.80

Net Charge*:
6.15

EC:
1.1.1.-  

Functional Class:
Unassigned  

Pathway: pathway table
Ascorbate and aldarate metabolism
Bile acid biosynthesis
Butanoate metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycine, serine and threonine metabolism
Lysine degradation
Nucleotide sugars metabolism
Phenylalanine metabolism
Tetrachloroethene degradation
Vitamin B6 metabolism

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to miscellaneous proteins including hypothetical proteins from E. coli (2492761) and H. pylori (7449077), a probable short-chain type dehydrogenase/reductase from H. pylori (2492758), among others.

HD0880 is similar to predicted 3-oxyacyl [acyl-carrier protein] reductases from C. trachomatis (CT237) and C. pneumoniae (CPn0296). No similarity to sequences from M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1028
COG name: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Functional Class: R
The phylogenetic pattern of COG1028 is a--KYQVCEBRHUJ----inX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002198 (Short-chain dehydrogenase/reductase (SDR) superfamily) with a combined E-value of 2.3e-09.
    IPB002198    124-159


ProDom Summary:  Protein Domain Search
Residues 170-266 are 42% similar to a (OXIDOREDUCTASE USHA-TESA PROTEOME) protein domain (PD061605) which is seen in Q9KTC3_VIBCH.

Residues 1-47 are 53% similar to a (OXIDOREDUCTASE DEHYDROGENASE RETINOL) protein domain (PD330606) which is seen in YBBO_ECOLI.

Residues 124-162 are 79% similar to a (OXIDOREDUCTASE DEHYDROGENASE COMPLETE PROTEOME NAD) protein domain (PD003795) which is seen in Q9KTC3_VIBCH.



Paralogs:  Local Blast Search
HD0880 is paralogously related to HD0708 (2e-12).


Pfam Summary:  Pfam Search
Residues 5 to 252 (E-value = 6.9e-45) place HD0880 in the adh_short family which is described as short chain dehydrogenase (PF00106)

PDB Hit:
pdb|1IOL| Estrogenic 17-Beta Hydroxysteroid Dehydrogenase Co... 116 3e-027
pdb|1FDW| Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 ... 115 7e-027
pdb|1FDU|C Chain C, Human 17-Beta-Hydroxysteroid-Dehydrogenase ... 115 7e-027

Gene Protein Sequence:
VMQTILITGCSSGIGYATAKLLKQQGWRVIASCRKTADIERLQAEGFECI
QLDVVDSAQIEQAFAYIRSSGGLDAVFCNAGQGQPGCVEDIPRSALRELF
ETNVFGVWEVMNQAIKIFREQQHGRILVTSSILGFAAMHYRGAYNATKFA
IEGMADTLRLELAGSNIYISLIEPGPILSDFRANSVDKLAKFIELEKTAD
LTFNQRQYRRLASRENDNPFAKPPSVVAEVCLVALTATKPRARYQVTFPT
KLFWWLRRILPTRWFDFVCRKSGG$

Gene Nucleotide Sequence:  Sequence Viewer
GTGATGCAAACAATTTTAATTACAGGTTGTTCATCTGGCATTGGTTATGC
AACGGCTAAACTATTAAAACAACAGGGTTGGCGAGTGATTGCAAGTTGCA
GAAAAACGGCAGATATTGAGCGCTTGCAAGCTGAAGGGTTTGAATGTATT
CAATTAGATGTTGTTGATTCCGCACAAATTGAGCAAGCATTTGCTTACAT
TAGATCAAGCGGTGGTTTAGATGCGGTATTTTGCAATGCAGGGCAAGGGC
AACCTGGTTGTGTTGAAGATATTCCGCGTAGTGCATTACGTGAATTATTT
GAAACTAATGTGTTTGGTGTTTGGGAAGTGATGAATCAAGCGATTAAAAT
TTTTCGTGAGCAACAACACGGGCGAATTTTAGTAACTAGCAGTATTTTGG
GGTTTGCGGCAATGCATTATCGTGGCGCCTATAATGCGACTAAATTTGCG
ATAGAAGGAATGGCAGATACTTTACGTCTTGAATTAGCCGGTTCAAATAT
TTATATCAGTTTAATTGAACCTGGACCTATTCTGAGTGATTTTAGGGCAA
ATTCAGTAGATAAATTAGCAAAATTTATTGAGCTAGAGAAAACGGCGGAT
CTGACTTTTAACCAAAGACAATATCGCCGTTTAGCCTCGCGCGAAAATGA
TAACCCTTTTGCTAAACCGCCATCAGTTGTTGCTGAGGTTTGTTTAGTTG
CTCTAACTGCCACTAAGCCTAGGGCGCGTTATCAAGTCACTTTCCCAACT
AAATTATTTTGGTGGTTACGCCGTATTTTACCGACCCGTTGGTTTGATTT
TGTGTGCCGTAAATCAGGTGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy