Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR628 IGR630 IGR626 IGR625 IGR629 IGR627 IGR624 HD0881 HD0876 pheA, - HD0873 ndh, - HD0874 sppA, - HD0878 HD0879 lsg-4, - HD0883 HD0880 lsg-1, - HD0882 HD0881 HD0876 pheA, - HD0873 ndh, - HD0874 sppA, - HD0878 HD0879 lsg-4, - HD0883 HD0880 lsg-1, - HD0882 HD0881 HD0876 pheA, - HD0873 ndh, - HD0874 sppA, - HD0878 HD0877 sprT, - HD0875 sprT, - HD0875 HD0877 HD0879 lsg-4, - HD0883 HD0880 lsg-1, - HD0882
* Calculated from Protein Sequence

Gene ID: HD0878

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sppA  

Definition:
protease IV, signal peptide peptidase sppA

Gene Start:
702566

Gene Stop:
700710

Gene Length:
1857

Molecular Weight*:
67964

pI*:
6.20

Net Charge*:
-6.01

EC:
3.4.-.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Biotin metabolism
Lysine degradation

Secondary Evidence:
Ichihara,S., Suzuki,T., Suzuki,M. and Mizushima,S.
Molecular cloning and sequencing of the sppA gene and characterization of the encoded protease IV, a signal peptide peptidase, of Escherichia coli.
J. Biol. Chem. 261(20): 9405-9411. 1986
Medline: 86250892.


Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to protease IV proteins from H. influenzae (1174428), E. coli (7428260, 134839, & 2118158), among others.

HD0878 is similar to predicted protease IV proteins from T. pallidum (TP0997), C. trachomatis (CT494) and C. pneumoniae (CPn0613). No similarity to sequences from M. genitalium, M. pneumoniae, or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0616
COG name: Periplasmic serine proteases
Functional Class: N
The phylogenetic pattern of COG0616 is aMtK-QvCEBrHuj---linX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002142 (Peptidase family U7) with a combined E-value of 8e-43.
    IPB002142A    364-373
    IPB002142B    397-446
    IPB002142C    503-529
    IPB002142B    142-191


ProDom Summary:  Protein Domain Search
Residues 347-424 are 41% similar to a (PROTEASE PROTEOME COMPLETE SOHB) protein domain (PD331650) which is seen in O34525_BACSU.

Residues 352-425 are 60% similar to a (PROTEASE IV PROTEOME COMPLETE) protein domain (PD007574) which is seen in Q9CMX9_PASMU.

Residues 351-425 are 43% similar to a (PROTEASE PROTEOME SPPA COMPLETE) protein domain (PD172671) which is seen in O83962_TREPA.

Residues 426-528 are 51% similar to a (PROTEASE IV PROTEOME COMPLETE) protein domain (PD002897) which is seen in SPPA_HAEIN.

Residues 548-617 are 39% similar to a (PROTEASE IV SPPA COMPLETE) protein domain (PD108865) which is seen in SPPA_HAEIN.

Residues 106-349 are 51% similar to a (PROTEASE IV PROTEOME COMPLETE) protein domain (PD036976) which is seen in SPPA_HAEIN.

Residues 106-338 are 45% similar to a (PROTEASE IV PROTEOME COMPLETE) protein domain (PD397638) which is seen in Q9CMX9_PASMU.



Paralogs:  Local Blast Search

HD0878 is paralogously related to HD0845 (6e-18).


Pfam Summary:  Pfam Search
Residues 133 to 290 (E-value = 1.9e-36) place HD0878 in the Peptidase_S49 family which is described as Peptidase family S49 (PF01343)
Residues 387 to 539 (E-value = 7e-55) place HD0878 in the Peptidase_S49 family which is described as Peptidase family S49 (PF01343)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLKLFKGIYAIFLCVRECIINLFFILFLLTGFASIAFLVNGSDTNKSKEP
NEKVALRLNLSGYLTDNHDDFAHRLIQSELTNDESLKASTFDVVRAIGKA
AKDPNITGIVLDLSKFEGSDHSSLSFIGSELKAFKTSGKPVIAIGENYSQ
SQYYLASFADKIYLNKAGSINLQGLNFSSLYFKALLDKIDAVPHIFRVGT
YKSAVEPFLRNDMSDEAKQNAQTLLNSIWHQFRTDIAENRMIAVDQVLPE
PKSLIEKYKAVNANDAQYALNQKLVTDIGSKAEIEQALIEQFGKNEKGIY
QHINYADYALNLTDRFAVNAEHKIAVINVEGEIISGKSKERSAGSETISE
LLRQAREDNNVDGVILRVNSPGGSVVASEIILQELQSIQQAGKPVVTSMG
GLAASGGYWISATSDKIIASPNTITGSIGIFGLAMTFEKTAKHLGISEDG
VATSPLAKTSSLQHLSNEHAELIQINIENGYDAFLDLVSRGRNMSKAEVD
KVAQGQVWSGEDALKHGLVDQLGDFHTAYDVLTDLINQKRKAKGENEIKH
FTAQWFIESDKGLFSSLLKNIGFKAKSTLAVWLGLPFVPQTQQAAELLQK
FNDPQNTYLYCLTCGTIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGAAGCTGTTTAAAGGTATTTATGCCATTTTTCTCTGTGTTCGCGA
ATGTATAATAAACCTCTTTTTTATTTTATTTCTATTGACGGGCTTTGCCT
CTATCGCCTTTTTAGTGAATGGAAGTGATACAAATAAAAGCAAAGAGCCT
AACGAAAAAGTAGCCTTGCGGCTTAATTTAAGCGGTTATTTAACAGATAA
CCACGATGATTTTGCTCACCGCTTAATTCAAAGCGAATTAACGAATGACG
AATCGCTCAAAGCGTCTACTTTTGATGTCGTACGTGCCATTGGCAAAGCG
GCGAAAGATCCAAATATTACGGGCATCGTGTTAGACCTTTCAAAATTTGA
AGGCAGTGATCATTCATCATTAAGTTTCATTGGTAGTGAATTAAAAGCCT
TTAAAACATCGGGTAAACCAGTGATTGCCATTGGGGAAAACTATAGTCAA
TCACAATATTATTTAGCCAGTTTTGCCGATAAAATTTATTTAAATAAAGC
AGGTTCAATCAATTTGCAAGGGTTGAATTTTAGTTCGCTTTATTTCAAAG
CCTTGCTCGATAAAATTGATGCTGTACCGCATATTTTCCGAGTAGGCACT
TATAAATCAGCGGTTGAACCATTCTTGCGCAATGATATGTCTGATGAAGC
AAAACAAAATGCGCAAACATTATTAAATTCAATTTGGCATCAATTCCGTA
CAGATATTGCTGAAAATCGTATGATTGCTGTCGATCAAGTTTTACCTGAA
CCCAAAAGCTTGATTGAAAAATACAAAGCCGTTAACGCTAATGACGCTCA
ATATGCCTTAAACCAAAAATTAGTGACCGATATCGGCAGTAAAGCAGAAA
TTGAACAAGCATTAATCGAACAATTCGGTAAAAATGAGAAAGGCATCTAT
CAACACATTAATTATGCCGATTATGCTTTGAATCTAACGGATCGTTTTGC
TGTCAATGCAGAACACAAAATTGCCGTGATTAATGTAGAAGGTGAAATTA
TTTCTGGCAAAAGCAAAGAAAGATCAGCGGGTAGTGAAACTATTTCTGAA
TTATTACGCCAAGCACGCGAAGACAATAATGTTGATGGTGTGATATTACG
AGTTAACAGCCCGGGAGGTAGCGTGGTTGCTTCTGAAATAATCTTGCAAG
AATTACAGTCTATTCAACAAGCCGGCAAACCTGTTGTAACCTCAATGGGG
GGCTTAGCTGCTTCAGGTGGCTATTGGATTTCAGCAACGAGCGATAAAAT
TATTGCCAGCCCAAATACGATCACAGGTTCAATTGGTATTTTTGGCTTAG
CCATGACCTTTGAAAAAACGGCTAAACATCTAGGCATAAGTGAAGATGGT
GTAGCCACTTCTCCATTAGCGAAAACAAGCTCGTTACAGCATCTATCGAA
TGAACATGCTGAATTAATTCAAATCAATATTGAAAATGGCTATGATGCTT
TCTTAGATTTAGTCAGTCGTGGTCGAAATATGTCAAAAGCTGAAGTAGAT
AAAGTTGCGCAAGGTCAAGTATGGTCTGGTGAAGATGCACTTAAGCACGG
CTTAGTCGATCAGCTAGGCGATTTCCATACTGCATATGATGTACTAACTG
ATTTAATCAATCAAAAACGTAAAGCCAAAGGCGAAAATGAAATTAAACAT
TTCACCGCGCAATGGTTTATTGAAAGTGATAAAGGTTTATTCAGTTCACT
CTTGAAAAATATTGGTTTTAAAGCTAAATCAACGCTAGCGGTTTGGTTGG
GTTTACCTTTTGTTCCCCAAACTCAACAAGCGGCTGAATTATTACAAAAA
TTTAATGACCCTCAAAACACTTATTTATATTGCCTGACTTGTGGCACGAT
AAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy