Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR628 IGR626 IGR625 IGR627 IGR622 IGR623 IGR624 IGR621 HD0868 HD0876 pheA, - HD0873 ndh, - HD0874 sppA, - HD0878 parE, - HD0870 HD0869 HD0872 HD0879 HD0880 HD0868 HD0876 pheA, - HD0873 ndh, - HD0874 sppA, - HD0878 parE, - HD0870 HD0869 HD0872 HD0879 HD0880 HD0868 HD0876 pheA, - HD0873 ndh, - HD0874 sppA, - HD0878 parE, - HD0870 HD0877 sprT, - HD0875 sprT, - HD0875 HD0877 HD0869 HD0872 HD0880 HD0879
* Calculated from Protein Sequence

Gene ID: HD0874

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ndh  

Definition:
NADH dehydrogenase

Gene Start:
699201

Gene Stop:
697915

Gene Length:
1287

Molecular Weight*:
47123

pI*:
9.30

Net Charge*:
8.73

EC:
1.6.99.3  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table

Secondary Evidence:
Young,I.G., Rogers,B.L., Campbell,H.D., Jaworowski,A. and Shaw,D.C.
Nucleotide sequence coding for the respiratory NADH dehydrogenase of Escherichia coli. UUG initiation codon.
Eur. J. Biochem. 116(1): 165-170, 1981.
Medline: 81236546.

David P, Baumann M, Wikstrom M, Finel M.
Interaction of purified NDH-1 from Escherichia coli with ubiquinone analogues.
Biochim Biophys Acta. 2002 Feb 15;1553(3):268-78.
PMID: 11997136

Lee AS, Teo AS, Wong SY.
Novel mutations in ndh in isoniazid-resistant Mycobacterium tuberculosis isolates.
Antimicrob Agents Chemother. 2001 Jul;45(7):2157-9.
PMID: 11408244

Green J, Anjum MF, Guest JR.
Regulation of the ndh gene of Escherichia coli by integration host factor and a novel regulator, Arr.
Microbiology. 1997 Sep;143 ( Pt 9):2865-75.
PMID: 9308170


Comment:
0

Blast Summary:  PSI-Blast Search
Several significant hits to probable NADH dehydrogenase proteins from E. coli (118590), H. influenzae (1169333),

HD0874 is similar to predicted NADH oxidase proteins from M. pneumoniae (MP0444) and M. genitalium (MG275) as well as to predicted dihydrolipoamide dehydrogenase component E3 proteins from M. genitalium (MG271), M. pneumoniae (MP0448), and, with weaker similarity, C. pneumoniae (CPn0833). No similarity to sequences from C. trachomatis or T. pallidum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1252
COG name: NADH dehydrogenase, FAD-containing subunit
Functional Class:  C
The phylogenetic pattern of COG1252 is ----Y--CeBRh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00368 (FAD-dependent pyridine nucleotide reductase signature) with a combined E-value of 5.5e-11.
    PR00368A    5-27
    PR00368B    116-125
    PR00368C    168-193
    PR00368E    305-312


ProDom Summary:  Protein Domain Search
Residues 169-311 are 56% similar to a (OXIDOREDUCTASE FLAVOPROTEIN FAD CENTER REDOX-ACTIVE) protein domain (PD000139) which is seen in DHNA_HAEIN.

Residues 207-310 are 55% similar to a (OXIDOREDUCTASE PROTEOME COMPLETE FAD) protein domain (PD330190) which is seen in Q9KQV8_VIBCH.

Residues 370-428 are 69% similar to a (NADH DEHYDROGENASE OXIDOREDUCTASE FAD) protein domain (PD402843) which is seen in DHNA_ECOLI.

Residues 6-94 are 74% similar to a (OXIDOREDUCTASE FLAVOPROTEIN FAD) protein domain (PD022954) which is seen in Q9KQV8_VIBCH.

Residues 111-156 are 69% similar to a (OXIDOREDUCTASE DEHYDROGENASE FAD) protein domain (PD342384) which is seen in DHNA_HAEIN.

Residues 148-205 are 53% similar to a (NADH DEHYDROGENASE OXIDOREDUCTASE FAD) protein domain (PD076286) which is seen in DHNA_ECOLI.

Residues 318-369 are 59% similar to a (DEHYDROGENASE OXIDOREDUCTASE FLAVOPROTEIN) protein domain (PD399524) which is seen in DHNA_HAEIN.

Residues 317-369 are 58% similar to a (NADH OXIDOREDUCTASE FAD FLAVOPROTEIN) protein domain (PD030302) which is seen in Q9KQV8_VIBCH.



Paralogs:  Local Blast Search


HD0874 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 319 (E-value = 5.6e-50) place HD0874 in the Pyr_redox family which is described as Pyridine nucleotide-disulphide oxidoreductase (PF00070)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAKETIIIVGGGAGGLELATYLGNKLSRKNKAHVLLIDRNTTHLWKPLLH
EVATGSLDEGIDALSYRAHAKNHGFEFQQGTLIAVDREQKQITLAPIYNE
QNELLVKERQVAYDKLVIAIGSKSNDFGTKGVAEHCIFLDDIKQAKLFQK
RMMELFLQFSHSDNQDVKIAIVGGGATGIELSAELYNTAKHLHEYGFGKL
HRASLKVTLVEASERLIPALTQKVSNSALYELRKAGVDVKLNTMITEAVE
NGLITQTGEKIEANLIVWSAGVKAPDFVKNLGFETNHLNQIEVKETLQTT
VDDAVYVIGDCASLMQDGKPIPPRAQAAHQMATQCGKNIIAALTGKELKP
FKFNDRGSLLSFSHFGTVGTLMGNLVSGNMFIEGKIARLAYLSLYRMHQV
ALHGWFKTGLILLVGQINRLLRPSMKLH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAAGAAACTATTATTATTGTTGGAGGAGGCGCGGGTGGTTTAGA
GCTAGCGACTTATTTAGGTAATAAATTAAGCCGTAAAAATAAAGCTCACG
TATTACTTATCGATCGTAATACAACACATTTATGGAAACCTTTATTACAC
GAAGTGGCAACAGGCTCACTCGATGAAGGTATTGATGCATTAAGTTATCG
TGCACACGCAAAAAATCACGGTTTTGAATTTCAACAAGGCACATTAATCG
CGGTTGATCGTGAACAAAAACAGATCACCCTTGCGCCCATTTATAATGAA
CAGAATGAATTACTGGTCAAAGAACGTCAAGTTGCTTACGACAAATTAGT
CATAGCCATCGGCAGTAAATCAAACGATTTTGGCACTAAAGGCGTTGCTG
AACATTGTATTTTCTTGGACGACATTAAACAGGCTAAATTATTCCAAAAA
CGAATGATGGAATTGTTTTTACAATTTTCACACAGTGATAATCAAGATGT
AAAAATTGCCATTGTCGGTGGTGGTGCAACAGGAATAGAACTCTCAGCAG
AACTCTATAACACCGCGAAACATTTACACGAATACGGCTTTGGTAAGTTA
CATCGTGCAAGTTTAAAAGTAACTTTAGTAGAAGCAAGCGAACGTTTAAT
TCCGGCTCTAACTCAAAAAGTGTCTAATTCAGCCCTATATGAATTACGCA
AAGCAGGGGTTGATGTAAAATTAAATACGATGATCACTGAAGCGGTCGAA
AATGGCTTAATTACCCAAACAGGGGAAAAAATTGAGGCCAATTTAATTGT
TTGGTCTGCCGGTGTAAAAGCACCTGATTTTGTCAAAAATCTAGGTTTTG
AAACAAATCATTTAAATCAAATTGAAGTCAAAGAGACATTACAAACTACC
GTAGATGATGCCGTTTATGTTATCGGTGATTGTGCTTCACTCATGCAAGA
TGGAAAACCAATTCCGCCACGTGCTCAAGCAGCACATCAAATGGCAACAC
AATGTGGCAAGAATATTATCGCCGCTTTAACGGGCAAAGAACTCAAACCA
TTTAAATTTAACGACAGAGGTTCTTTATTATCATTTTCTCATTTTGGCAC
GGTTGGCACCTTAATGGGTAACTTAGTCAGCGGTAATATGTTTATTGAGG
GTAAAATTGCCCGCTTGGCCTATCTATCACTGTATCGAATGCACCAAGTG
GCATTACATGGTTGGTTCAAAACTGGCTTAATTTTATTAGTCGGTCAGAT
TAACCGACTGTTAAGACCTTCAATGAAATTACACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy