Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR626 IGR625 IGR620 IGR622 IGR623 IGR624 IGR621 HD0868 HD0876 pheA, - HD0873 HD0866 ndh, - HD0874 sppA, - HD0878 parE, - HD0870 HD0869 HD0872 HD0868 HD0876 pheA, - HD0873 HD0866 ndh, - HD0874 sppA, - HD0878 parE, - HD0870 HD0869 HD0872 HD0868 HD0876 pheA, - HD0873 HD0866 ndh, - HD0874 sppA, - HD0878 parE, - HD0870 HD0877 sprT, - HD0875 sprT, - HD0875 HD0877 HD0869 HD0872
* Calculated from Protein Sequence

Gene ID: HD0873

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pheA  

Definition:
P-protein (chorismate mutase/prephenate dehydratase)

Gene Start:
697733

Gene Stop:
696570

Gene Length:
1164

Molecular Weight*:
44069

pI*:
6.30

Net Charge*:
-4.18

EC:
4.2.1.51  5.4.99.5  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Zhang S, Pohnert G, Kongsaeree P, Wilson DB, Clardy J, Ganem B. 1998.
Chorismate mutase-prephenate dehydratase from Escherichia coli. Study of catalytic and regulatory domains using genetically engineered proteins.
J Biol Chem. 273(11):6248-53.
Medline: 9497350.

Fischer RS, Zhao G, Jensen RA. 1991.
Cloning, sequencing, and expression of the P-protein gene (pheA) of Pseudomonas stutzeri in Escherichia coli: implications for evolutionary relationships in phenylalanine biosynthesis.
J Gen Microbiol. 137 (Pt 6):1293-301.
Medline: 1919506.

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to P-proteins (which include chorismate mutase and prephenate dehydratase) from H. influenzae (1172476), Erwinia herbicola(266771), E. coli (130050), among others.

No similarity to sequences from C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0077
COG name: Prephenate dehydratase
Functional Class: E
The phylogenetic pattern of COG0077 is amt-yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001086 (Prephenate dehydratase (PDT)) with a combined E-value of 9.3e-52.
    IPB001086A    108-120
    IPB001086B    154-175
    IPB001086C    184-195
    IPB001086D    205-222
    IPB001086E    252-285
    IPB001086F    299-351
***** IPB002701 (Chorismate mutase) with a combined E-value of 4.8e-10.
    IPB002701    5-37


ProDom Summary:  Protein Domain Search
Residues 5-88 are 63% similar to a (CHORISMATE PROTEOME COMPLETE MUTASE) protein domain (PD005194) which is seen in Q9CPA3_PASMU.

Residues 108-382 are 60% similar to a (DEHYDRATASE CHORISMATE PREPHENATE PHENYLALANINE) protein domain (PD002231) which is seen in PHEA_HAEIN.



Paralogs:  Local Blast Search
HD0873 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 89 (E-value = 4.4e-17) place HD0873 in the Chorismate_mut family which is described as Chorismate mutase (PF01817)
Residues 108 to 290 (E-value = 6.3e-62) place HD0873 in the PDT family which is described as Prephenate dehydratase (PF00800)

PDB Hit:
pdb|1ECM|B Chain B, P-Protein, Chorismate Mutase Domain Mol_id:... 76 5e-015

Gene Protein Sequence:
MPLNLSNIRTQITQLDHDLLKLLAERHQLAFDVLRDKQITEIPLRDRTRE
TELLNALIKYAEAQQYDLDEEYITQIFQCIMKDSILTQQAYFKDNLKQER
ENNKKISIAFLGMAGSYSSMAAKQFAKKQQNVMIELNCNSFQEVFEKVEG
DLAQIGILPLENSTSGSINEVYDLLQHTNLTIIDEIVYPIKHCILANREA
TLEDIDTIYMHPEHEKQCSQALEKLGKIDIKYCKSSSHAMSLAACLNKPN
IAALSSEAGGKLYDLTNIKTNITNQEHNITRFIIVAKKAVPVSPQLQTKI
LLLMTSKKQAGILVDVLSIFKQHKIRMLKLVSRPIYGEDWEEMFYVELEA
NIDSAKTQQALAELQKITCYLKVVGCYPSEVVQPVQP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTTTAAATTTATCAAACATAAGAACTCAAATTACACAATTAGATCA
CGACTTACTCAAACTACTTGCTGAACGTCATCAATTAGCCTTTGATGTGC
TGCGTGATAAACAAATAACCGAGATCCCATTACGCGATCGTACACGGGAA
ACTGAATTATTGAATGCATTAATAAAATATGCTGAAGCGCAGCAATATGA
TCTTGATGAAGAATATATCACTCAAATCTTTCAATGCATTATGAAAGATT
CCATTCTTACACAACAAGCCTATTTCAAAGATAATCTAAAACAAGAAAGA
GAAAATAATAAGAAAATATCTATCGCTTTCTTAGGTATGGCTGGCTCTTA
TTCAAGTATGGCTGCCAAGCAATTTGCGAAAAAACAACAAAATGTAATGA
TTGAGCTAAACTGTAATTCATTTCAAGAAGTGTTTGAAAAAGTTGAAGGC
GATTTAGCACAAATTGGTATCTTACCATTAGAAAATTCCACCTCAGGCTC
AATCAATGAAGTATACGATCTTTTACAACACACCAATTTAACTATCATTG
ATGAAATCGTTTATCCGATTAAACACTGTATTTTAGCTAATCGAGAAGCA
ACGTTAGAAGATATTGATACCATCTATATGCATCCCGAACACGAGAAACA
GTGTAGTCAAGCCTTAGAAAAGTTAGGCAAAATTGATATTAAATATTGCA
AAAGTAGTTCGCATGCAATGAGTTTAGCCGCTTGTCTAAATAAACCCAAT
ATTGCAGCGTTGTCTAGTGAAGCGGGCGGTAAATTATACGATCTGACTAA
TATTAAAACGAATATTACCAATCAAGAACATAATATTACTCGCTTTATCA
TCGTAGCGAAAAAAGCCGTGCCCGTTTCACCACAACTTCAAACTAAAATA
TTGTTACTGATGACAAGCAAAAAACAAGCGGGTATTTTAGTTGATGTATT
AAGCATTTTTAAACAACATAAAATTCGCATGCTCAAATTAGTATCACGCC
CAATTTATGGCGAGGATTGGGAAGAAATGTTTTACGTTGAATTAGAAGCA
AATATTGATTCAGCCAAAACCCAACAAGCTTTAGCTGAATTGCAAAAGAT
AACGTGCTACTTAAAAGTAGTCGGCTGTTACCCTAGTGAAGTAGTGCAGC
CAGTACAGCCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy