Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR614 IGR617 IGR615 IGR618 IGR619 IGR620 IGR622 IGR616 IGR621 HD0868 sapF, - HD0863 fba, - HD0864 pgk, - HD0865 HD0866 parE, - HD0870 HD0869 lolD,devA, - HD0860 kdsA, - HD0857 lolE, - HD0861 lolC, - HD0858 HD0868 sapF, - HD0863 fba, - HD0864 pgk, - HD0865 HD0866 parE, - HD0870 HD0869 lolD,devA, - HD0860 kdsA, - HD0857 lolE, - HD0861 lolC, - HD0858 HD0868 sapF, - HD0863 fba, - HD0864 pgk, - HD0865 HD0866 parE, - HD0870 HD0869 lolD,devA, - HD0860 kdsA, - HD0857 lolE, - HD0861 lolC, - HD0858
* Calculated from Protein Sequence

Gene ID: HD0864

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fba  

Definition:
fructose-bisphosphate aldolase class II

Gene Start:
690823

Gene Stop:
689747

Gene Length:
1077

Molecular Weight*:
39236

pI*:
5.20

Net Charge*:
-9.19

EC:
4.1.2.13  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Fructose and mannose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate cycle

Secondary Evidence:
Berry,A. and Marshall,K.E.
Identification of zinc-binding ligands in the class II fructose-1,6-bisphosphate aldolase of Escherichia coli.
FEBS Lett. 318(1): 11-16, 1993
Medline: 93170474.

Alefounder,P.R. and Perham,R.N
Identification, molecular cloning and sequence analysis of a gene cluster encoding the class II fructose 1,6-bisphosphate aldolase, 3-phosphoglycerate kinase and a putative second glyceraldehyde 3-phosphate dehydrogenase of Escherichia coli.
Mol. Microbiol. 3(6): 723-732, . 1989.
Medline: 89313302.

Alefounder,P.R., Baldwin,S.A., Perham,R.N. and Short,N.J.
Cloning, sequence analysis and over-expression of the gene for the class II fructose 1,6-bisphosphate aldolase of Escherichia coli. Biochem. J. 257(2): 529-534, 1989.
Medline: 89193446.

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to fructose-bisphosphate aldolases from H. influenzae (1168413), E. coli (113620), Edwardsiella ictaluri (6686371), Campylobacter jejuni (1703246), among others.

HD0864 is similar to predicted fructose-bisphosphate aldolases from M. genitalium (MG023), M. pneumoniae (MP0129), U. urealyticum (UU596), and T. pallidum (TP0662). No similarity to sequences from C. trachomatis or C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0191
COG name: Fructose/tagatose biphosphate aldolases
Functional Class: G
The phylogenetic pattern of COG0191 is ----yqvcEBrhujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000771 (Fructose-bisphosphate aldolase, class-II) with a combined E-value of 6.4e-88.
    IPB000771A    24-62
    IPB000771B    102-113
    IPB000771C    149-185
    IPB000771D    218-230
    IPB000771E    263-294
    IPB000771F    324-341


ProDom Summary:  Protein Domain Search
Residues 13-358 are 86% similar to a (ALDOLASE LYASE FRUCTOSE-BISPHOSPHATE ZINC) protein domain (PD002376) which is seen in ALF_HAEIN.



Paralogs:  Local Blast Search
HD0864 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 13 to 358 (E-value = 1.2e-211) place HD0864 in the F_bP_aldolase family which is described as Fructose-bisphosphate aldolase class-II (PF01116)

PDB Hit:
pdb|1B57|A Chain A, Class Ii Fructose-1,6-Bisphosphate Aldolase... 517 1e-147
pdb|1DOS|A Chain A, Structure Of Fructose-Bisphosphate Aldolase... 513 1e-146

Gene Protein Sequence:
MALLDIVKPGVVTGDDVQKIFAYAKANNFAIPAVNCVGSNSVNTVLETAA
RVKAPVIIQFSNGGASFYAGKGIKPTSGARADVLGAIAGAKQVHLLAEEY
GVPVILHTDHAAKKLLPWIDSLLEASEKHFAETGKPLFSSHMLDLSEEPM
EENMAICREYLARMSKMDMTLEIEIGITGGEEDGVDNSNVDESRLYTQPE
DVLYVYDQLHPISPRFTIAAAFGNVHGVYKPGNVKLKPSILGDSQEFVSA
QRNLPAKSINFVFHGGSGSSREEIRQAISYGAIKMNIDTDTQWASWDGIL
NFYKANEAYLQGQLGNPDGPSAPNKKYYDPRVWLRKMEESMSKRLEQSFE
DLNCINVL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCATTATTAGATATCGTAAAACCCGGTGTAGTAACAGGCGATGATGT
TCAAAAAATCTTTGCGTATGCTAAAGCAAATAATTTTGCAATTCCAGCCG
TTAACTGTGTAGGTTCTAATTCAGTCAATACCGTTTTAGAAACTGCTGCA
CGCGTTAAAGCCCCCGTTATTATTCAATTTTCGAATGGTGGGGCTTCATT
TTATGCAGGCAAAGGCATCAAACCAACAAGCGGGGCAAGGGCGGATGTAT
TAGGTGCGATTGCTGGTGCTAAGCAAGTACATTTACTGGCTGAAGAATAT
GGTGTGCCCGTTATCTTACATACCGATCACGCTGCCAAAAAATTATTACC
TTGGATCGATAGCCTATTAGAAGCAAGTGAGAAACATTTTGCTGAAACGG
GTAAACCATTATTTTCTTCACATATGCTTGATTTATCTGAAGAACCAATG
GAAGAGAATATGGCGATTTGCCGTGAATACCTTGCACGAATGAGCAAAAT
GGATATGACGCTAGAAATCGAAATTGGTATTACCGGCGGTGAAGAAGATG
GCGTTGATAATTCTAATGTAGATGAGTCGCGTTTATATACTCAACCCGAA
GATGTATTATATGTTTATGATCAATTACATCCGATCAGCCCGCGATTTAC
CATAGCGGCAGCCTTTGGGAATGTACACGGTGTTTATAAACCAGGTAATG
TGAAGTTAAAACCATCTATTTTAGGTGATTCACAAGAATTTGTGTCTGCA
CAACGTAATTTACCTGCAAAATCAATTAATTTTGTGTTCCATGGTGGCTC
AGGATCATCACGCGAAGAGATCCGCCAAGCGATCAGTTATGGTGCAATCA
AAATGAATATTGATACTGATACACAATGGGCATCGTGGGACGGTATTTTA
AACTTCTACAAAGCAAATGAAGCATATCTGCAAGGTCAATTAGGCAATCC
GGACGGCCCTAGCGCACCAAACAAAAAATATTATGATCCACGTGTTTGGT
TACGTAAAATGGAAGAATCTATGTCAAAACGCTTAGAACAATCTTTCGAA
GACTTAAACTGCATAAATGTATTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy