Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR614 IGR613 IGR617 IGR615 IGR618 IGR612 IGR611 IGR616 sapF, - HD0863 fba, - HD0864 lolD,devA, - HD0860 kdsA, - HD0857 HD0856 hemK,hemG, - HD0855 prfA, - HD0853 lolE, - HD0861 lolC, - HD0858 HD0852 sapF, - HD0863 fba, - HD0864 lolD,devA, - HD0860 kdsA, - HD0857 HD0856 hemK,hemG, - HD0855 prfA, - HD0853 lolE, - HD0861 lolC, - HD0858 HD0852 sapF, - HD0863 fba, - HD0864 lolD,devA, - HD0860 kdsA, - HD0857 HD0856 hemK,hemG, - HD0855 prfA, - HD0853 lolE, - HD0861 lolC, - HD0858 HD0852
* Calculated from Protein Sequence

Gene ID: HD0857

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
kdsA  

Definition:
2-dehydro-3-deoxyphosphooctonate aldolase

Gene Start:
684748

Gene Stop:
685608

Gene Length:
861

Molecular Weight*:
31297

pI*:
5.50

Net Charge*:
-4.41

EC:
4.1.2.16  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Lipopolysaccharide biosynthesis

Secondary Evidence:
Strohmaier,H., Remler,P., Renner,W. and Hogenauer,G.
Expression of genes kdsA and kdsB involved in
3-deoxy-D-manno-octulosonic acid metabolism and biosynthesis of
enterobacterial lipopolysaccharide is growth phase regulated
primarily at the transcriptional level in Escherichia coli K-12
J. Bacteriol. 177 (15), 4488-4500 (1995)
M:95362678

Woisetschlaeger,M. and Hoegenauer,G.
The kdsA gene coding for 3-deoxy-D-manno-octulosonic acid
8-phosphate synthetase is part of an operon in Escherichia coli
Mol. Gen. Genet. 207, 369-373 (1987)
M:87286380


Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to 2-dehydro-3-deoxyphosphooctonate aldolase from Actinobacillus pleuropneumoniae (6647547), Pasteurella haemolytica (2498500), H. influenzae (1170637), among others. HD0857 is 83% similar to residues 5-285 from KDSA_ACTPL.

HD0857 is similar to phospho-2-dehydro-3-deoxyoctonate aldolase from C. pneumoniae (CPn0721) and C. trachomatis (CT655), and to phospho-2-dehydro-3-deoxyheptonate aldolase (CPn0484, CT382). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0722
COG name: DAHP synthase/3-Deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
Functional Class:  E,M
The phylogenetic pattern of COG0722 is ----YqvcEb-Huj----INx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-270 are 84% similar to a (ALDOLASE SYNTHETASE) protein domain (PD005860) which is seen in KDSA_ACTPL.



Paralogs:  Local Blast Search


HD0857 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 276 (E-value = 1.6e-125) place HD0857 in the DAHP_synth_1 family which is described as DAHP synthetase I family (PF00793)

PDB Hit:
pdb|1D9E|A Chain A, Structure Of E. Coli Kdo8p Synthase >gi|856... 435 4e-123

Gene Protein Sequence:
MANKSVTVGQLEIANDRPFTLFGGMNVLESRDMAMRVCEKYVAVTNKLNV
PYIFKASFDKANRSSIHSYRGPGMEEGLKIFQELKQTFGVNIITDVHEIY
QCQPVAEVVDIIQLPAFLARQTDLVEAMARTGAVINVKKPQFLSPGQMGN
IVEKIVECGNQQIILCDRGTNFGYDNLVVDMLSFNIMKKVSDGCPVIFDV
THALQCRDPFGSASGGRRDQVTELARAGLATGLAGLFLEAHPDPNTAKCD
GPSALPLDKLEAFVAQMKAIDNLVKSFAELDTACRD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGAATAAATCTGTAACAGTTGGTCAGCTAGAGATCGCAAATGATAG
ACCATTTACATTGTTTGGTGGAATGAATGTGTTAGAAAGCCGTGATATGG
CGATGCGTGTTTGTGAAAAATATGTAGCAGTGACAAATAAATTAAATGTT
CCCTATATATTTAAAGCTTCTTTTGATAAAGCAAATCGTTCGTCTATTCA
TTCATACCGTGGGCCAGGTATGGAAGAAGGCTTAAAGATTTTCCAAGAAT
TGAAACAAACATTTGGCGTTAATATTATCACCGATGTGCATGAAATCTAT
CAATGTCAGCCGGTTGCTGAAGTGGTTGATATTATTCAATTGCCTGCATT
TTTAGCACGGCAAACAGATTTAGTGGAAGCTATGGCGCGCACAGGCGCAG
TAATTAATGTCAAAAAACCACAATTTTTAAGCCCAGGGCAAATGGGGAAT
ATTGTTGAAAAAATTGTAGAATGTGGCAATCAGCAAATTATTCTTTGCGA
TCGCGGTACAAATTTTGGCTATGATAATTTAGTGGTCGATATGCTTAGCT
TTAACATTATGAAAAAAGTCTCTGATGGTTGTCCTGTTATTTTTGATGTA
ACGCATGCCTTACAATGTCGAGATCCATTTGGTTCTGCCTCTGGCGGTCG
CCGTGATCAAGTGACTGAATTAGCGCGTGCGGGGTTAGCGACTGGATTAG
CGGGGCTATTTTTAGAAGCACATCCAGATCCAAATACAGCAAAATGCGAT
GGTCCATCAGCTTTACCTCTTGACAAGTTAGAAGCCTTTGTCGCACAAAT
GAAAGCGATTGATAATTTAGTCAAATCTTTTGCTGAGCTTGATACTGCTT
GTCGTGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy