Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR614 IGR609 IGR613 IGR615 IGR612 IGR611 IGR616 IGR610 dnaA, - HD0851 lolD,devA, - HD0860 kdsA, - HD0857 HD0856 hemK,hemG, - HD0855 prfA, - HD0853 lolE, - HD0861 lolC, - HD0858 HD0852 dnaA, - HD0851 lolD,devA, - HD0860 kdsA, - HD0857 HD0856 hemK,hemG, - HD0855 prfA, - HD0853 lolE, - HD0861 lolC, - HD0858 HD0852 dnaA, - HD0851 lolD,devA, - HD0860 kdsA, - HD0857 HD0856 hemK,hemG, - HD0855 prfA, - HD0853 lolE, - HD0861 lolC, - HD0858 HD0852
* Calculated from Protein Sequence

Gene ID: HD0855

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
hemK  hemG  

Definition:
protoporphyrinogen oxidase

Gene Start:
682981

Gene Stop:
683853

Gene Length:
873

Molecular Weight*:
32756

pI*:
5.40

Net Charge*:
-7.06

EC:
1.3.3.4  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Nakayashiki,T., Nishimura,K. and Inokuchi,H.
Cloning and sequencing of a previously unidentified gene that is
involved in the biosynthesis of heme in Escherichia coli
Gene 153 (1), 67-70 (1995)
M:95189105


Comment:
0

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to from H. influenzae (1170230), E. coli (2506506, 2126015), Neisseria meningitidis (7379122), among others. HD0855 is 47% similar to residues 1-291 from HEMK_HAEIN.

HD0855 is similar to protoporphyrinogen oxidase from T. pallidum (TP0052), C. trachomatis (CT024), U. urealyticum (UU004), M. genitalium (MG259), and M. pneumoniae (MP0474), and similar to A/G specific methylase from C. pneumoniae (CPn0114).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0500
COG name: SAM-dependent methyltransferases
Functional Class:  R
The phylogenetic pattern of COG0500 is AMTKYQVCEBRHUJgPOLINX
Number of proteins in this genome belonging to this COG is 11

Blocks Summary:  Blocks Search
***** PR00507 (N12 class N6 adenine-specific DNA methyltransferase signature) with a combined E-value of 1.7e-06.
    PR00507B    124-138
    PR00507C    189-201


ProDom Summary:  Protein Domain Search
Residues 189-282 are 42% similar to a (METHYLTRANSFERASE COMPLETE PROTEOME METHYLASE HOMOLOG) protein domain (PD005237) which is seen in Q9CHX0_LACLA.

Residues 227-285 are 50% similar to a (PROTEOME COMPLETE TRANSFERASE) protein domain (PD353265) which is seen in Q9CN82_PASMU.

Residues 188-225 are 76% similar to a (PROTEOME COMPLETE HEMK TRANSFERASE) protein domain (PD089786) which is seen in Q9CN82_PASMU.

Residues 6-109 are 50% similar to a (COMPLETE PROTEOME METHYLTRANSFERASE) protein domain (PD001640) which is seen in HEMK_ECOLI.



Paralogs:  Local Blast Search
HD0855 is paralogously related to HD1686 (9e-21), HD0168 (6e-06) and HD0210 (4e-04).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNYTEWLNYATTVLQANLVHDPYLNPKIDANLLLQAVTKKSKAMLFAFGE
THLSHDQLAELTLLLQRRQKGEPIAYILGEKEFWSLPLKVSKHTLIPRPD
TERVVEIALDWAYKRLEQQTNLHILDLGTGTGAIALALASELGDKAVITA
VDIKAEAVSLAEENRQHLGFKQVTFLQSDWFNALQSQQFDLIVSNPPYID
KTDENLKLGDVRFEPLSALVSAQQGLSDLYKIIENAPLYLTAKGALILEH
GWQQATAVQQFFQHYDWDEIQSWQDYAGLDRVTKGVIKAK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTACACAGAATGGTTGAATTATGCAACTACGGTGCTTCAAGCTAA
CCTTGTCCACGATCCTTATCTTAATCCTAAAATAGATGCTAATTTATTGT
TACAAGCGGTCACAAAAAAATCAAAAGCAATGCTGTTTGCTTTTGGCGAA
ACACACCTTTCTCACGATCAATTAGCTGAATTAACGCTATTATTGCAACG
TCGGCAAAAAGGTGAGCCAATCGCTTATATTTTAGGCGAAAAAGAGTTTT
GGTCATTGCCTTTGAAAGTGTCTAAACATACGCTTATTCCGCGGCCAGAT
ACAGAAAGAGTGGTAGAAATTGCACTTGATTGGGCTTATAAGCGCTTAGA
ACAGCAAACGAATTTGCATATATTAGATTTAGGTACTGGCACGGGCGCCA
TTGCGCTAGCATTAGCTTCAGAGCTAGGTGATAAGGCCGTTATAACGGCG
GTTGATATCAAGGCAGAAGCGGTCAGTTTAGCAGAAGAAAATCGCCAACA
TTTGGGTTTTAAGCAAGTTACTTTTTTACAGAGTGATTGGTTTAATGCAT
TACAATCTCAACAATTTGATTTGATTGTAAGTAATCCTCCTTATATTGAT
AAAACAGATGAAAACCTGAAGCTGGGTGATGTACGATTTGAGCCACTTTC
TGCTTTAGTTTCAGCGCAACAAGGGTTGAGTGATTTGTATAAAATTATTG
AAAATGCCCCCCTTTATTTGACAGCTAAAGGTGCATTAATCTTAGAACAC
GGTTGGCAGCAAGCTACAGCCGTTCAGCAGTTTTTCCAACATTATGATTG
GGACGAAATTCAATCTTGGCAAGATTATGCAGGTTTGGATCGTGTGACCA
AGGGAGTAATAAAAGCAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy