Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR601 IGR609 IGR607 IGR608 IGR604 IGR600 IGR603 IGR602 IGR605 IGR606 nudE, - HD0841 cysQ, - HD0840 recF, - HD0849 dnaN, - HD0850 asd, - HD0847 lpxB, - HD0846 dnaA, - HD0851 gap,G6PD, - HD0838 hslR, - HD0842 sodC, - HD0848 hslO,hsp33, - HD0843 nudE, - HD0841 cysQ, - HD0840 recF, - HD0849 dnaN, - HD0850 asd, - HD0847 lpxB, - HD0846 dnaA, - HD0851 gap,G6PD, - HD0838 hslR, - HD0842 sodC, - HD0848 hslO,hsp33, - HD0843 nudE, - HD0841 cysQ, - HD0840 recF, - HD0849 dnaN, - HD0850 asd, - HD0847 lpxB, - HD0846 dnaA, - HD0851 gap,G6PD, - HD0838 sohB, - HD0845 sohB, - HD0845 hslR, - HD0842 sodC, - HD0848 hslO,hsp33, - HD0843
* Calculated from Protein Sequence

Gene ID: HD0846

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lpxB  

Definition:
lipid-A-disaccharide synthase

Gene Start:
674097

Gene Stop:
672925

Gene Length:
1173

Molecular Weight*:
43609

pI*:
8.50

Net Charge*:
6.12

EC:
2.4.1.182  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Lipopolysaccharide biosynthesis

Primary Evidence:
NULL

Secondary Evidence:
Servos,S., Khan,S. and Maskell,D.
Cloning and expression of genes encoding lipid A biosynthesis from
Haemophilus influenzae type b
Gene 175 (1-2), 137-141 (1996)
M:97074663

Crowell,D.N., Reznikoff,W.S. and Raetz,C.R.
Nucleotide sequence of the Escherichia coli gene for lipid A
disaccharide synthase
J. Bacteriol. 169 (12), 5727-5734 (1987)
M:88058790

Coleman,J. and Raetz,C.R.
First committed step of lipid A biosynthesis in Escherichia coli:
sequence of the lpxA gene
J. Bacteriol. 170 (3), 1268-1274 (1988)
M:88139188


Comment:
For other "lpx" genes, see HD1187 (lpxA), HD1189 (lpxD), HD0816 (lpxC).

Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to lipid-A-disaccharide synthase from H. influenzae (1694783, 2507058), E. coli (7429050), Neisseria meningitidis (), among others. HD0847 is 73% similar to residues 1-389 from LPXB_HAEIN.

HD0847 is similar to lipid A disaccharide synthase from C. pneumoniae(CPn0965) and C. trachomatis (CT411). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0763
COG name: Lipid A disaccharide synthetase
Functional Class:  M
The phylogenetic pattern of COG0763 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003835 (Lipid-A-disaccharide synthetase) with a combined E-value of 6.9e-43.
    IPB003835A    19-73
    IPB003835B    115-131


ProDom Summary:  Protein Domain Search
Residues 8-116 are 77% similar to a (SYNTHASE PROTEOME COMPLETE LIPID) protein domain (PD231234) which is seen in LPXB_HAEIN.

Residues 117-384 are 74% similar to a (PROTEOME COMPLETE SYNTHASE LIPID) protein domain (PD014237) which is seen in LPXB_HAEIN.



Paralogs:  Local Blast Search


HD0846 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 380 (E-value = 3.2e-183) place HD0846 in the LpxB family which is described as Lipid-A-disaccharide synthetase (PF02684)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSKDSPLIALVAGEISGDILGAGLINALKIHYPNARFIGVAGPQMIQAGC
QTLFDMEELAVMGLAEVVKHLPRLLKRRKQVIQTMLQQQPDIFIGIDAPD
FNLTIEQKLKAKGITTIHYVSPSVWAWRQDRIHKIKRATNLVLAFLPFEK
AFYDRFNVACRFIGHTMADAIALKPNRTEACQILNIDENQRYLAILAGSR
ASEVDFLAEPFLKAALLLKQKYPDLQCLVPLVNQQRIQQFEQIKARVAPS
LPVKILKGNARQAMIAADATLLASGTAALEAMLCKSPMVVGYKLKPTSYW
LAKRLIKTKYISLPNLLADDMLVPELIQDECNPENLAWYLGNYLADDIDN
KKQQNELKQRFTDLHKMIQCDADSKAAQAVIDLLANSDDQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAAAGACTCCCCGCTTATCGCGCTTGTTGCTGGTGAAATTTCTGG
TGATATTTTAGGCGCTGGGCTGATCAACGCGCTAAAAATTCATTACCCAA
ATGCACGTTTTATTGGCGTAGCCGGTCCTCAAATGATTCAAGCGGGTTGT
CAAACATTGTTTGATATGGAAGAGCTGGCGGTGATGGGGTTGGCTGAAGT
GGTCAAACATTTACCGCGTTTACTCAAACGCCGTAAACAAGTGATTCAAA
CAATGCTTCAGCAACAACCTGATATATTTATTGGCATTGACGCGCCTGAT
TTCAATTTAACAATTGAACAAAAATTGAAAGCAAAGGGCATCACGACTAT
TCACTATGTGAGCCCTTCAGTATGGGCATGGCGTCAGGATCGCATACATA
AAATTAAACGTGCCACAAATTTAGTCCTGGCCTTTTTGCCATTCGAAAAA
GCCTTTTACGATCGTTTTAATGTTGCTTGTCGTTTTATTGGCCATACTAT
GGCAGATGCAATTGCTCTGAAGCCTAACCGTACTGAGGCATGCCAAATAT
TAAATATTGATGAAAACCAACGTTACTTAGCGATTCTAGCCGGCAGTCGT
GCTAGTGAAGTAGACTTTTTGGCTGAACCATTTTTAAAAGCGGCGCTCCT
ACTAAAACAGAAATATCCTGATCTACAATGCTTAGTACCATTAGTCAATC
AACAACGTATCCAACAATTTGAGCAGATCAAAGCGAGAGTAGCGCCTTCC
TTACCGGTCAAAATCCTAAAGGGTAATGCTCGCCAAGCGATGATTGCGGC
AGATGCTACGTTATTAGCTTCTGGCACAGCTGCACTGGAAGCGATGTTAT
GTAAATCTCCGATGGTCGTCGGTTATAAGCTAAAACCAACGAGCTATTGG
TTAGCAAAACGTTTGATCAAAACAAAATATATTTCATTACCCAATTTATT
AGCTGATGATATGTTAGTGCCTGAATTGATCCAAGATGAATGTAACCCTG
AAAATTTAGCTTGGTATCTGGGTAATTATTTAGCAGATGATATCGACAAT
AAAAAGCAACAAAATGAATTAAAACAACGCTTCACCGATTTACATAAAAT
GATTCAATGTGATGCGGATTCAAAAGCAGCTCAAGCGGTTATTGATCTAT
TAGCAAATAGCGATGATCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy