Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR601 IGR607 IGR608 IGR604 IGR600 IGR603 IGR602 IGR605 IGR606 nudE, - HD0841 cysQ, - HD0840 recF, - HD0849 dnaN, - HD0850 asd, - HD0847 lpxB, - HD0846 gap,G6PD, - HD0838 hslR, - HD0842 sodC, - HD0848 hslO,hsp33, - HD0843 nudE, - HD0841 cysQ, - HD0840 recF, - HD0849 dnaN, - HD0850 asd, - HD0847 lpxB, - HD0846 gap,G6PD, - HD0838 hslR, - HD0842 sodC, - HD0848 hslO,hsp33, - HD0843 nudE, - HD0841 cysQ, - HD0840 recF, - HD0849 dnaN, - HD0850 asd, - HD0847 lpxB, - HD0846 gap,G6PD, - HD0838 sohB, - HD0845 sohB, - HD0845 hslR, - HD0842 sodC, - HD0848 hslO,hsp33, - HD0843
* Calculated from Protein Sequence

Gene ID: HD0845

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sohB  

Definition:
possible secreted protease SohB

Gene Start:
672935

Gene Stop:
671835

Gene Length:
1101

Molecular Weight*:
40917

pI*:
9.90

Net Charge*:
9.15

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Baird,L., Lipinska,B., Raina,S. and Georgopoulos,C.
Identification of the Escherichia coli sohB gene, a multicopy
suppressor of the HtrA (DegP) null phenotype
J. Bacteriol. 173 (18), 5763-5770 (1991)
Medline: 91358368


Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to secreted protease from Neisseria meningitidis (7380420), H. influenzae (1174392), E. coli (2507253), among others. HD0845 is 61% similar to residues 1-367 from gb|AAF41940.1.

HD0845 is similar to protease IV from T. pallidum (TP0997), C. pneumoniae (CPn0613), and C. trachomatis (CT494). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0616
COG name: Periplasmic serine proteases
Functional Class: N
The phylogenetic pattern of COG0616 is aMtK-QvCEBrHuj---linX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002142 (Peptidase family U7) with a combined E-value of 3.8e-45.
    IPB002142A    154-163
    IPB002142B    187-236
    IPB002142C    292-318


ProDom Summary:  Protein Domain Search
Residues 216-326 are 29% similar to a (PROTEASE IV PROTEOME COMPLETE) protein domain (PD002897) which is seen in O34525_BACSU.

Residues 213-355 are 72% similar to a (PROTEASE PROTEOME COMPLETE POSSIBLE) protein domain (PD345864) which is seen in Q9JYH3_NEIMB.

Residues 16-79 are 51% similar to a (PROTEOME COMPLETE PROTEASE SECRETED) protein domain (PD349763) which is seen in Q9JYH3_NEIMB.

Residues 104-212 are 73% similar to a (PROTEASE PROTEOME COMPLETE HYDROLASE) protein domain (PD036979) which is seen in Q9JTH2_NEIMA.



Paralogs:  Local Blast Search

HD0845 is paralogously related to HD0878 (3e-18).


Pfam Summary:  Pfam Search
Residues 177 to 328 (E-value = 2.1e-61) place HD0845 in the Peptidase_S49 family which is described as Peptidase family S49 (PF01343)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MINNVTNLFNKENESMWKEILLNYGIFLLELLTIFGIIAMVIMLMLADRK
NAASGAIAITNLTEKYKEQQEALANFLLSEEAQKQSERKAKKLAKQKVKE
EKRRLKAGEEKLADAEKARLFVLKFNGDLHASAVQSLRKEVSAIISVARP
QDEVLLQLESPGGVVHGYGLAASQLQRLRDHHIPLTVAVDKVAASGGYMM
ACVANKIVAAPFAILGSVGVVAQVPNIHRFLKKHEIDVDVMTAGEYKRTV
TLAGENTEKGKQKFQQELEETHQLFKQFVANNRPQLEIEKVATGEHWFGQ
QALTLNLIDEIATSDDLILNAVKDKEVIKLAFKQKKKLAQRLGSQMEQSL
ENLIAKLLHKNRSNML$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCAATAACGTAACCAATCTATTTAATAAGGAAAATGAATCAATGTG
GAAAGAAATATTACTTAATTACGGTATTTTTTTATTAGAGTTACTCACTA
TATTTGGCATTATTGCAATGGTGATTATGTTAATGCTAGCCGATCGTAAA
AACGCCGCCTCAGGCGCCATCGCTATTACCAACTTAACGGAAAAATATAA
AGAACAACAAGAAGCGCTAGCTAATTTTTTATTAAGCGAAGAAGCACAAA
AACAGAGTGAGCGAAAAGCTAAGAAATTAGCTAAACAAAAAGTGAAAGAA
GAAAAAAGGCGCTTAAAAGCCGGTGAGGAAAAACTTGCCGATGCAGAAAA
AGCACGCTTATTTGTCTTGAAATTTAATGGTGATCTACATGCAAGCGCCG
TACAGTCGTTACGTAAAGAAGTAAGTGCAATTATTAGTGTAGCAAGACCA
CAAGATGAAGTACTGTTACAATTAGAAAGCCCCGGCGGTGTTGTGCATGG
TTATGGTTTAGCCGCGTCACAACTACAACGATTGCGCGATCACCATATTC
CATTAACAGTAGCTGTCGATAAAGTCGCGGCAAGCGGTGGTTATATGATG
GCATGTGTTGCAAATAAAATTGTCGCCGCGCCTTTTGCTATTCTAGGTTC
TGTTGGTGTAGTTGCTCAAGTGCCCAATATCCATCGCTTCCTCAAAAAAC
ACGAGATTGATGTAGATGTGATGACCGCAGGCGAATATAAACGGACAGTA
ACCTTAGCCGGTGAAAATACTGAAAAAGGTAAACAAAAATTCCAACAAGA
GTTAGAAGAAACACATCAATTATTTAAACAATTTGTGGCAAATAACCGTC
CTCAGCTTGAAATTGAAAAAGTAGCCACAGGCGAACATTGGTTTGGCCAA
CAAGCATTAACGTTAAATCTGATCGATGAAATTGCAACCAGTGATGATTT
AATATTAAATGCCGTCAAAGACAAAGAAGTCATTAAACTAGCCTTTAAAC
AAAAGAAAAAGTTAGCACAACGTTTAGGCTCACAAATGGAACAATCACTC
GAAAACCTCATTGCTAAGCTATTACATAAAAACCGATCAAATATGCTTTA
G


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy