Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR601 IGR598 IGR599 IGR604 IGR600 IGR603 IGR602 IGR605 IGR597 nudE, - HD0841 pgl,devB, - HD0836 cysQ, - HD0840 asd, - HD0847 lpxB, - HD0846 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 hslR, - HD0842 hslO,hsp33, - HD0843 nudE, - HD0841 pgl,devB, - HD0836 cysQ, - HD0840 asd, - HD0847 lpxB, - HD0846 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 hslR, - HD0842 hslO,hsp33, - HD0843 nudE, - HD0841 pgl,devB, - HD0836 cysQ, - HD0840 asd, - HD0847 lpxB, - HD0846 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 sohB, - HD0845 sohB, - HD0845 hslR, - HD0842 hslO,hsp33, - HD0843
* Calculated from Protein Sequence

Gene ID: HD0841

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nudE  

Definition:
ADP compounds hydrolase nudE

Gene Start:
670262

Gene Stop:
669717

Gene Length:
546

Molecular Weight*:
20727

pI*:
5.00

Net Charge*:
-5.27

EC:
3.6.1.-  

Functional Class:
Cellular processes; Other  

Pathway: pathway table
Folate biosynthesis
Lipopolysaccharide biosynthesis
Starch and sucrose metabolism

Secondary Evidence:
O'Handley,S.F., Frick,D.N., Dunn,C.A. and Bessman,M.J.
Orf186 represents a new member of the Nudix hydrolases, active on
adenosine(5')triphospho(5')adenosine, ADP-ribose, and NADH
J. Biol. Chem. 273 (6), 3192-3197 (1998)
Medline: 98123081


Comment:


Blast Summary:  PSI-Blast Search
Few significant hits using gapped BLAST to conserved hypothetical protein from E. coli (1176862),Thermotoga maritima (7445034), Bacillus subtilis (1731093), among others. HD0841 is 55% similar to residues 8-180 from YRFE_ECOLI.


HD0841 is similar to conserved hypothetical protein from T. pallidum, (TP0731). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, M. genitalium, or M. pneumoniae.



COGS Summary:  COGS Search
BeTs to 11 clades of COG0494
COG name: NTP pyrophosphohydrolases (MutT family) including oxidative damage repair enzymes
Functional Class: L,R
The phylogenetic pattern of COG0494 is a-T-YqvCEBRHuj---linx
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB000086 (NUDIX hydrolase) with a combined E-value of 9.4e-08.
    IPB000086    74-100


ProDom Summary:  Protein Domain Search
Residues 47-116 are 54% similar to a (COMPLETE PROTEOME HYDROLASE MUTATOR MUTT/NUDIX FAMILY) protein domain (PD000653) which is seen in Q9CKR2_PASMU.

Residues 7-46 are 57% similar to a (PROTEOME COMPLETE HYDROLASE PA5176) protein domain (PD403757) which is seen in Q9KNL1_VIBCH.

Residues 117-179 are 60% similar to a (PROTEOME COMPLETE HYDROLASE PA5176) protein domain (PD103898) which is seen in Q9CKR2_PASMU.

Residues 48-116 are 52% similar to a (PROTEOME COMPLETE HYDROLASE PA5176) protein domain (PD265984) which is seen in NUDE_ECOLI.



Paralogs:  Local Blast Search
HD0841 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 45 to 176 (E-value = 6.2e-15) place HD0841 in the NUDIX family which is described as NUDIX domain (PF00293)

PDB Hit:
pdb|1TUM| Mutt Pyrophosphohydrolase-Metal-Nucleotide-Metal Co... 158 5e-040

Gene Protein Sequence:
MSKPTLPHILDVKTIAKTRIFEVQSVDLRFSNGEERVYERLTPNRRASVL
VIPIQDNQLIFIKEYAVASERYELSFPKGIVDANEQPIESANRELQEEIG
LAANRLDFLRSLYSGPSHMFSLMHIFVAQDLYKSKLIGDEPEPLSIVRYP
LTEIDTLLADSNFAEARNLAALFMLREFLNQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAAACCAACATTACCACACATTCTTGACGTTAAAACTATTGCAAA
AACACGCATTTTTGAGGTTCAATCTGTCGATTTACGCTTCTCAAATGGTG
AAGAGCGTGTTTATGAGCGTTTGACCCCTAATCGCCGAGCTTCTGTATTA
GTCATTCCTATTCAAGATAATCAATTAATTTTTATTAAAGAATATGCAGT
AGCAAGCGAACGCTATGAATTGAGTTTTCCTAAGGGGATCGTTGACGCAA
ATGAACAACCGATCGAAAGTGCAAATCGTGAATTGCAAGAAGAAATAGGT
TTAGCCGCCAATCGGCTTGATTTTCTCCGTTCACTTTATAGCGGACCTAG
CCATATGTTTAGCTTAATGCACATATTCGTTGCGCAAGACTTATACAAAT
CAAAATTAATCGGAGATGAGCCTGAACCACTTAGTATCGTACGCTATCCT
TTAACTGAAATTGATACGCTATTAGCAGATTCTAATTTTGCTGAAGCCCG
TAATTTAGCCGCATTATTTATGTTGCGTGAATTTTTAAATCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy