Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR601 IGR598 IGR599 IGR604 IGR600 IGR596 IGR603 IGR602 IGR597 nudE, - HD0841 pgl,devB, - HD0836 cysQ, - HD0840 lpxB, - HD0846 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 hslR, - HD0842 cysZ, - HD0832 hslO,hsp33, - HD0843 nudE, - HD0841 pgl,devB, - HD0836 cysQ, - HD0840 lpxB, - HD0846 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 hslR, - HD0842 cysZ, - HD0832 hslO,hsp33, - HD0843 nudE, - HD0841 pgl,devB, - HD0836 cysQ, - HD0840 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 sohB, - HD0845 sohB, - HD0845 lpxB, - HD0846 hslR, - HD0842 cysZ, - HD0832 hslO,hsp33, - HD0843
* Calculated from Protein Sequence

Gene ID: HD0838

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gap  G6PD  

Definition:
glucose-6-phosphate dehydrogenase

Gene Start:
668822

Gene Stop:
667335

Gene Length:
1488

Molecular Weight*:
56301

pI*:
6.40

Net Charge*:
-4.92

EC:
1.1.1.49  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Glutathione metabolism
Pentose phosphate cycle

Secondary Evidence:
Yoshida,Y., Nakano,Y., Yamashita,Y. and Koga,T.
The gnd gene encoding a novel 6-phosphogluconate dehydrogenase and
its adjacent region of Actinobacillus actinomycetemcomitans
chromosomal DNA
Biochem. Biophys. Res. Commun. 230 (1), 220-225 (1997)
M:97148607


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to glucose 6 phosphate dehydrogenase from H. influenzae (1169801),Actinobacillus actinomycetemcomitans (2494654),Nostoc punctiforme (1346072) among others. HD0838 is 78% similar to residues 1-494 from G6PD_HAEIN.

HD0838 is similar to glucose-6-phosphate dehydrogenase from T. pallidum (TP0478), C. pneumoniae (CPn0238) and C. trachomatis (CT185). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 11 clades of COG0364
COG name: Glucose-6-phosphate 1-dehydrogenase
Functional Class:  G
The phylogenetic pattern of COG0364 is ----yqvcebRhuj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001282 (Glucose-6-phosphate dehydrogenase) with a combined E-value of 6e-163.
    IPB001282A    8-25
    IPB001282B    112-124
    IPB001282C    178-205
    IPB001282D    209-255
    IPB001282E    303-356
    IPB001282F    370-392
    IPB001282G    416-451
    IPB001282H    463-473


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0838 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 189 (E-value = 1.6e-97) place HD0838 in the G6PD_N family which is described as Glucose-6-phosphate dehydrogenase, NAD binding domain (PF00479)
Residues 191 to 487 (E-value = 2.9e-182) place HD0838 in the G6PD_C family which is described as Glucose-6-phosphate dehydrogenase, C-terminal domain (PF02781)

PDB Hit:
pdb|1QKI|H Chain H, X-Ray Structure Of Human Glucose 6-Phosphat... 331 1e-091
pdb|1DPG|A Chain A, Glucose 6-Phosphate Dehydrogenase From Leuc... 318 8e-088
pdb|1E77|A Chain A, Complex Of Active Mutant (Q365->c) Of Gluco... 318 1e-087

Gene Protein Sequence:
MNIENSCIVIFGASGDLTFRKLIPALYNLFKVGRLGEHFSVLGVSRSDLT
HDSFRQKMREALIKYEQASGQFLDDFCNHLYYQAINTADPDDYAKLLPCL
DELHNKYGSCGNTLYYLSTPPSLYGIIPECLAAHGLTTEEYGWKRIIIEK
PFGYDIKTAKQLDEKIHHYFEEHQIYRIDHYLGKETVQNLLVLRFSNGLF
EPLWNRNFIEYVEITGAESLGVEDRGGYYDGSGAMRDMFQNHLLQVLAMV
AMEPPAIINANSMRNEVAKVLYSLRPLSTEDVKNNVVLGQYTSGEIDDLV
VPGYTEENGVPNDSNTETYLAVKCEIDNWRWAGVPFYVRTGKRLPTRVTE
IVIHFKTTPHPVFSQNAPENKLIIRVQPDEGISMRFGLKKPGAGFEAKEV
SMDFRYSDLSSASSLLTAYERLLLDALKGDATLFARTDAVHACWHFVQPI
LDYKAERGRVYEYEASSWGPKEADKLIARNGKVWRKPSGMMKKKI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATATAGAAAATAGTTGTATCGTAATTTTTGGTGCATCAGGGGACTT
AACATTCCGTAAACTTATCCCAGCACTATATAATCTTTTTAAAGTAGGTC
GGTTAGGCGAACATTTTTCTGTTTTAGGTGTTTCACGATCAGACCTAACT
CACGATTCTTTTAGACAAAAAATGCGTGAAGCATTAATCAAATATGAGCA
AGCAAGCGGGCAGTTTTTAGATGATTTTTGCAATCACTTGTATTATCAAG
CAATCAACACCGCTGATCCGGACGATTATGCCAAACTATTACCTTGTTTA
GATGAATTACACAATAAATACGGTAGCTGTGGTAACACTTTATATTACCT
TTCAACACCGCCTAGTTTATACGGCATTATCCCTGAATGCTTGGCGGCTC
ACGGCTTAACCACTGAAGAATATGGTTGGAAACGGATTATCATCGAAAAA
CCATTTGGTTACGATATTAAAACAGCCAAACAACTCGATGAGAAAATACA
TCATTATTTTGAAGAACATCAAATTTACCGGATCGATCATTATCTTGGTA
AAGAAACCGTGCAAAATTTATTAGTACTCCGTTTCTCAAACGGTTTATTT
GAACCACTTTGGAATCGTAATTTTATTGAATATGTAGAAATTACCGGTGC
AGAATCATTAGGTGTTGAAGATCGTGGTGGTTATTATGATGGATCTGGTG
CAATGCGTGATATGTTCCAAAACCATTTACTACAAGTATTAGCAATGGTT
GCCATGGAACCTCCGGCCATTATTAATGCTAACTCAATGCGTAATGAAGT
AGCAAAAGTCTTATATAGCTTACGTCCATTAAGCACTGAAGACGTCAAAA
ATAATGTGGTACTTGGTCAATATACCTCCGGTGAAATTGATGACTTAGTT
GTACCCGGTTATACTGAAGAAAATGGCGTTCCCAACGATTCAAATACAGA
AACTTATTTAGCCGTAAAATGCGAAATTGATAACTGGCGTTGGGCCGGCG
TGCCATTTTATGTGCGAACAGGTAAGCGTTTGCCTACTCGGGTAACTGAA
ATCGTAATCCACTTCAAAACGACTCCACATCCAGTCTTTAGCCAAAATGC
GCCTGAAAATAAATTAATTATCCGGGTACAACCTGATGAAGGTATTTCTA
TGCGGTTTGGTTTGAAAAAACCCGGTGCTGGTTTTGAGGCGAAAGAAGTC
TCTATGGATTTTCGCTATTCTGATTTAAGCTCTGCTTCAAGTTTATTAAC
CGCTTATGAACGGTTACTATTAGATGCATTAAAAGGAGATGCGACCCTAT
TTGCCCGAACCGATGCCGTACATGCCTGTTGGCATTTCGTACAGCCGATT
CTAGACTATAAGGCAGAACGTGGCCGAGTGTATGAATATGAAGCAAGCAG
TTGGGGGCCTAAAGAAGCTGATAAACTGATTGCACGCAATGGCAAAGTAT
GGCGTAAACCGTCTGGAATGATGAAGAAAAAAATATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy