Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR601 IGR598 IGR599 IGR604 IGR600 IGR596 IGR603 IGR602 IGR595 IGR597 nudE, - HD0841 pgl,devB, - HD0836 cysQ, - HD0840 zipA, - HD0831 sohB, - HD0845 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 hslR, - HD0842 cysZ, - HD0832 hslO,hsp33, - HD0843 nudE, - HD0841 pgl,devB, - HD0836 cysQ, - HD0840 zipA, - HD0831 sohB, - HD0845 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 hslR, - HD0842 cysZ, - HD0832 hslO,hsp33, - HD0843 nudE, - HD0841 pgl,devB, - HD0836 cysQ, - HD0840 zipA, - HD0831 sohB, - HD0845 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 hslR, - HD0842 cysZ, - HD0832 hslO,hsp33, - HD0843
* Calculated from Protein Sequence

Gene ID: HD0836

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pgl  devB  

Definition:
6-phosphogluconolactonase

Gene Start:
667278

Gene Stop:
666577

Gene Length:
702

Molecular Weight*:
26483

pI*:
6.50

Net Charge*:
-2.69

EC:
3.1.1.31  

Functional Class:
Other categories; Other  

Pathway: pathway table
Pentose phosphate cycle

Secondary Evidence:
Yoshida,Y., Nakano,Y., Yamashita,Y. and Koga,T.
The gnd gene encoding a novel 6-phosphogluconate dehydrogenase and
its adjacent region of Actinobacillus actinomycetemcomitans
chromosomal DNA
Biochem. Biophys. Res. Commun. 230 (1), 220-225 (1997)
Medline: 97148607


Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to glucose-6-phosphate dehydrogenase from H. influenzae (7404327), Actinobacillus actinomycetemcomitans (7404326), Synechocystis PCC6803 (2829619), among others. Also a hit to Sol1 protein homolog from H. influenzae (1075172). HD0836 is 75% similar to residues 1-231 from 6PGL_HAEIN and 72% similar to residues 1-162 of Sol1 protein from pir||D64077.

HD0836 is similar to glucose-6-phosphate dehydrogenase isozyme from T. pallidum (TP0477), C. pneumoniae (CPn0239), and C. trachomatis (CT186). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 10 clades of COG0363
COG name: Glucosamine-6-phosphate deaminase (Glucosamine-6-phosphate isomerase)
Functional Class: G
The phylogenetic pattern of COG0363 is ----Y-vcEBrHuj--Olin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000457 (Glucosamine/galactosamine-6-phosphate isomerase) with a combined E-value of 2.2e-47.
    IPB000457A    31-73
    IPB000457B    117-169
    IPB000457C    172-226


ProDom Summary:  Protein Domain Search
Residues 32-152 are 79% similar to a (6-PHOSPHOGLUCONOLACTONASE HYDROLASE GLUCOSE) protein domain (PD004927) which is seen in Q9CKQ6_PASMU.

Residues 154-231 are 73% similar to a (PROTEOME COMPLETE) protein domain (PD404397) which is seen in Q9CKQ6_PASMU.



Paralogs:  Local Blast Search
HD0836 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MHYLIFPTAQCAVEKIAQEFILYSQLNRPVHISLSGGSTPKLLFKTLAQI
PYINQINWQNLHFWWGDDRMVPATDPESNYGEVQKLLFDHIQIPPTNIHS
IRGEQPPETELARFTQELNECLPNLTFDWIILGMGNDGHTASLFPYQTDF
ADQHLAIIAKHPVTGQLRISKTAKLIEQAARITYLVTGQSKATILKEIHD
LPATQLAYPAAHIRAKNGITEWYLDQQAAELFR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATTACCTTATTTTCCCAACGGCACAATGTGCCGTTGAAAAAATAGC
GCAAGAGTTTATTTTATATAGTCAATTAAATCGCCCTGTACATATTTCAT
TATCGGGCGGTAGCACACCAAAATTACTCTTCAAAACCTTGGCTCAAATA
CCTTATATAAACCAAATTAACTGGCAAAACTTACATTTTTGGTGGGGTGA
TGATCGAATGGTGCCGGCAACCGATCCTGAGAGTAATTATGGCGAAGTAC
AAAAATTACTATTTGATCATATTCAAATTCCACCAACCAATATTCATAGT
ATTCGAGGTGAGCAACCTCCTGAAACTGAACTGGCAAGATTTACTCAAGA
ATTAAATGAATGCCTGCCTAATTTAACTTTTGATTGGATCATCTTAGGTA
TGGGAAATGATGGCCATACCGCTTCGCTATTCCCCTATCAAACAGATTTT
GCTGATCAGCATCTTGCAATTATCGCAAAACACCCCGTAACCGGACAATT
ACGTATTTCAAAAACAGCCAAGCTAATTGAACAAGCAGCGCGTATTACTT
ATTTAGTTACTGGTCAATCCAAAGCCACTATATTGAAAGAGATCCACGAC
TTACCGGCAACACAATTAGCTTATCCTGCGGCGCATATCCGCGCAAAAAA
CGGGATAACCGAGTGGTACTTAGATCAACAAGCGGCTGAATTATTCCGTT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy