Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR598 IGR599 IGR593 IGR600 IGR596 IGR594 IGR595 IGR597 pgl,devB, - HD0836 cysQ, - HD0840 zipA, - HD0831 galE, - HD0829 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 ligN,lig, - HD0830 cysZ, - HD0832 pgl,devB, - HD0836 cysQ, - HD0840 zipA, - HD0831 galE, - HD0829 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 ligN,lig, - HD0830 cysZ, - HD0832 pgl,devB, - HD0836 cysQ, - HD0840 zipA, - HD0831 galE, - HD0829 vanK,hppK, - HD0835 gnd, - HD0833 gap,G6PD, - HD0838 ligN,lig, - HD0830 cysZ, - HD0832
* Calculated from Protein Sequence

Gene ID: HD0833

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gnd  

Definition:
6-phosphogluconate dehydrogenase

Gene Start:
665115

Gene Stop:
663661

Gene Length:
1455

Molecular Weight*:
53261

pI*:
4.90

Net Charge*:
-15.36

EC:
1.1.1.44  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Pentose phosphate cycle

Secondary Evidence:
Tarr PI, Schoening LM, Yea YL, Ward TR, Jelacic S, Whittam TS.
Acquisition of the rfb-gnd cluster in evolution of Escherichia coli O55 and O157.
J Bacteriol. 2000 Nov;182(21):6183-91.
PMID: 11029441


Yoshida Y, Nakano Y, Yamashita Y, Koga T.
The gnd gene encoding a novel 6-phosphogluconate dehydrogenase and its adjacent region of Actinobacillus actinomycetemcomitans chromosomal DNA.
Biochem Biophys Res Commun. 1997 Jan 3;230(1):220-5.
PMID: 9020051

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to from H. influenzae (1168235), Actinobacillus actinomycetemcomitans (2492494), Neisseria meningitidis (7225240), among others. HD0833 is 88% similar to residues 1-484 from 6PGD_HAEIN.

HD0833 is similar to 6-phosphogluconate dehydrogenase from T. pallidum (TP0331), C. pneumoniae (CPn0360), and C. trachomatis (CT063). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0362
COG name: 6-phosphogluconate dehydrogenase, family 1
Functional Class:  G
The phylogenetic pattern of COG0362 is ----Y-vceBrh----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001744 (6-phosphogluconate dehydrogenase) with a combined E-value of 4.4e-232.
    IPB001744A    13-39
    IPB001744B    50-87
    IPB001744C    96-147
    IPB001744D    167-202
    IPB001744E    212-243
    IPB001744F    245-289
    IPB001744G    343-396
    IPB001744H    426-456


ProDom Summary:  Protein Domain Search
Residues 12-49 are 84% similar to a (DEHYDROGENASE 6-PHOSPHOGLUCONATE) protein domain (PD403136) which is seen in 6PGD_CUNEL.

Residues 264-470 are 86% similar to a (DEHYDROGENASE 6-PHOSPHOGLUCONATE) protein domain (PD001549) which is seen in 6PGD_HAEIN.

Residues 3-49 are 87% similar to a (DEHYDROGENASE 6-PHOSPHOGLUCONATE) protein domain (PD001594) which is seen in Q9JWS3_NEIMA.

Residues 51-88 are 92% similar to a (PENTOSE NADP OXIDOREDUCTASE SHUNT) protein domain (PD412653) which is seen in 6PGD_HAEIN.

Residues 89-240 are 86% similar to a (DEHYDROGENASE 6-PHOSPHOGLUCONATE OXIDOREDUCTASE SHUNT) protein domain (PD001025) which is seen in 6PGD_ACTAC.



Paralogs:  Local Blast Search


HD0833 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 177 (E-value = 2.7e-134) place HD0833 in the NAD_binding_2 family which is described as NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446)
Residues 179 to 471 (E-value = 2.1e-230) place HD0833 in the 6PGD family which is described as 6-phosphogluconate dehydrogenase, C-terminal domain (PF00393)

PDB Hit:
pdb|2PGD| 6-Phosphogluconate Dehydrogenase (6-Pgdh) (E.C.1.1... 631 0.0
pdb|1PGJ|A Chain A, X-Ray Structure Of 6-Phosphogluconate Dehyd... 301 2e-082

Gene Protein Sequence:
MSIKGDIGVIGLAVMGQNLILNMNDNGFKVVAYNRTASKVDEFLAGEAKD
TNIIGAYSLEDLAAKLEKPRKIMLMVRAGEVVDQFIDALLPHLEAGDIII
DGGNSNYPDTNRRTITLAEKGIRFIGTGVSGGEEGARHGPSIMPGGNEEA
WPFVKPILQAISAKTDKDEPCCDWVGKEGAGHFVKMVHNGIEYGDMQLIC
EAYQFLKDGLGLNYEEMHAIFADWKNTELDSYLIDITADILAYKDADGEP
LVEKILDTAGQKGTGKWTGINALDFGIPLTLITEAVFARCVSAFKDQRVA
VSQLFNKTITPISDDKKEWIEAVRKALLASKIISYAQGFMLIREASENFE
WNINYGATALLWREGCIIRSAFLGNIRDAYEANPGLVFLGSDPYFQNILQ
SAMADWRKVVAKSIEIGIPMPCMAAAITFLDGYSSEHLPANLLQAQRDYF
GAHTYERTDKPRCSFFHTNWTGRGGNTASTTYDV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAATCAAAGGTGATATCGGCGTTATTGGCTTAGCCGTAATGGGACA
AAACTTAATTTTAAATATGAATGACAACGGCTTCAAAGTTGTCGCATATA
ATCGTACTGCATCAAAAGTAGATGAATTTTTAGCGGGCGAAGCAAAAGAT
ACCAACATAATTGGCGCTTATTCTTTAGAAGATTTAGCCGCTAAATTAGA
AAAACCACGCAAAATAATGTTAATGGTACGTGCAGGCGAAGTCGTTGATC
AATTTATTGATGCTTTACTACCACATTTAGAAGCAGGCGATATTATTATT
GATGGTGGTAACTCTAACTACCCTGATACCAACCGCCGTACTATAACACT
AGCCGAAAAAGGCATTCGTTTTATAGGAACAGGCGTGTCAGGCGGTGAAG
AAGGTGCCCGCCACGGTCCGTCTATTATGCCGGGCGGTAATGAAGAAGCT
TGGCCATTCGTCAAACCTATTTTACAAGCAATCTCCGCAAAAACAGATAA
AGATGAGCCTTGTTGTGATTGGGTTGGTAAAGAAGGTGCTGGCCATTTTG
TTAAGATGGTGCACAACGGTATAGAATATGGCGATATGCAATTAATTTGT
GAAGCTTATCAATTCTTAAAAGATGGCTTAGGTTTAAACTATGAAGAAAT
GCACGCGATCTTTGCAGATTGGAAAAATACCGAGCTAGATAGCTACTTAA
TCGATATTACCGCAGATATTCTTGCATATAAAGATGCAGATGGTGAGCCA
CTCGTTGAGAAAATTTTAGATACTGCCGGTCAAAAAGGAACAGGTAAATG
GACGGGCATCAATGCGTTAGACTTTGGTATTCCATTGACGTTAATTACTG
AAGCGGTCTTTGCGCGTTGTGTTTCTGCCTTTAAGGATCAACGTGTTGCC
GTATCACAATTATTCAATAAAACCATTACCCCTATATCAGACGATAAAAA
AGAATGGATTGAAGCGGTCAGAAAAGCATTGTTAGCTTCGAAAATTATTT
CTTATGCACAAGGTTTTATGCTGATTCGTGAAGCATCAGAAAACTTTGAA
TGGAATATTAACTATGGCGCCACTGCATTATTATGGCGTGAAGGTTGTAT
TATTCGTTCTGCCTTTTTAGGTAATATCCGTGATGCCTATGAAGCGAACC
CAGGTTTAGTGTTCTTAGGTTCAGATCCTTATTTCCAAAATATTTTACAA
TCCGCAATGGCAGATTGGCGTAAAGTAGTGGCTAAATCCATTGAAATAGG
TATTCCAATGCCATGTATGGCCGCTGCAATCACGTTCTTAGATGGTTACA
GCTCAGAGCATCTGCCTGCTAATTTATTACAAGCACAACGTGACTACTTT
GGCGCGCATACTTATGAGCGAACAGATAAACCACGTTGTTCATTCTTCCA
TACAAATTGGACAGGCCGTGGCGGTAATACAGCTTCAACGACTTATGATG
TTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy