Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR592 IGR593 IGR596 IGR594 IGR591 IGR595 IGR597 IGR590 adk, - HD0826 zipA, - HD0831 galE, - HD0829 murG, - HD0824 HD0827 vanK,hppK, - HD0835 gnd, - HD0833 ligN,lig, - HD0830 cysZ, - HD0832 adk, - HD0826 zipA, - HD0831 galE, - HD0829 murG, - HD0824 HD0827 vanK,hppK, - HD0835 gnd, - HD0833 ligN,lig, - HD0830 cysZ, - HD0832 adk, - HD0826 zipA, - HD0831 galE, - HD0829 murG, - HD0824 HD0827 vanK,hppK, - HD0835 gnd, - HD0833 ligN,lig, - HD0830 cysZ, - HD0832
* Calculated from Protein Sequence

Gene ID: HD0830

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ligN  lig  

Definition:
DNA ligase (polydeoxyribonucleotide synthase)

Gene Start:
661515

Gene Stop:
659455

Gene Length:
2061

Molecular Weight*:
76281

pI*:
6.70

Net Charge*:
-1.94

EC:
6.5.1.2  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Ishino,Y., Shinagawa,H., Makino,K., Tsunasawa,S., Sakiyama,F. and
Nakata,A.
Nucleotide sequence of the lig gene and primary structure of DNA
ligase of Escherichia coli
Mol. Gen. Genet. 204 (1), 1-7 (1986)
Medline: 86310292

Georlette,D., Jonsson,Z.O., Van Petegem,F., Chessa,J.-P., Van
Beeumen,J., Huebscher,U. and Gerday,C.
A DNA ligase from the psychrophile Pseudoalteromonas haloplanktis
gives insights into the adaptation of proteins to low temperatures
Eur. J. Biochem. 267, 3502-3512 (2000)

Comment:
From Genbank:[gi:1169385]
This protein catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double-stranded DNA using NAD as a coenzyme and the energy source for the reaction. It is essential for DNA replication and repair of damaged DNA.



Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to DNA Ligase from H. influenzae (1169385), E. coli (2506362), Pseudoalteromonas haloplanktis (5733399), among others. HD0830 is 71% similar to residues 15-673 from DNLJ_HAEIN.

HD0830 is similar to DNA Ligase from C. pneumoniae (CPn0149), C. trachomatis (CT146), M. pneumoniae (MP0479), M. genitalium (MG254), U. urealyticum (UU121), and T. pallidum (TP0634).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0272
COG name: NAD-dependent DNA ligase (contains BRCT domain type II)
Functional Class: L
The phylogenetic pattern of COG0272 is -----qvcEbrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001679 (NAD-dependent DNA ligase) with a combined E-value of 5.9e-246.
    IPB001679A    28-53
    IPB001679B    67-103
    IPB001679C    121-167
    IPB001679D    207-231
    IPB001679E    290-340
    IPB001679F    359-401
    IPB001679G    417-426
    IPB001679H    445-487
    IPB001679I    508-549
    IPB001679J    611-621
    IPB001679K    636-668


ProDom Summary:  Protein Domain Search
Residues 603-676 are 59% similar to a (DNA LIGASE NAD REPLICATION) protein domain (PD002763) which is seen in Q9CKA9_PASMU.

Residues 538-593 are 53% similar to a (DNA LIGASE NAD REPAIR) protein domain (PD041672) which is seen in Q9RBF2_ALTHA.

Residues 462-537 are 38% similar to a (LIGASE PROTEOME COMPLETE DNA) protein domain (PD407355) which is seen in Q9K0E3_NEIMB.

Residues 537-579 are 69% similar to a (DNA NAD LIGASE POLYDEOXYRIBONUCLEOTIDE) protein domain (PD403795) which is seen in Q9CKA9_PASMU.

Residues 464-554 are 41% similar to a (DNA NAD LIGASE REPAIR) protein domain (PD399181) which is seen in DNLJ_ZYMMO.

Residues 462-535 are 78% similar to a (DNA LIGASE NAD SYNTHASE) protein domain (PD001207) which is seen in DNLJ_HAEIN.



Paralogs:  Local Blast Search


HD0830 is paralogously related to HD1709 (8e-04).


Pfam Summary:  Pfam Search
Residues 12 to 331 (E-value = 7.2e-186) place HD0830 in the DNA_ligase_aden family which is described as NAD-dependent DNA ligase adenylation domain (PF01653)
Residues 333 to 415 (E-value = 4e-49) place HD0830 in the DNA_ligase_OB family which is described as NAD-dependent DNA ligase OB-fold domain (PF03120)
Residues 419 to 447 (E-value = 4.4e-12) place HD0830 in the DNA_ligase_ZBD family which is described as NAD-dependent DNA ligase C4 zinc finger domain (PF03119)
Residues 604 to 680 (E-value = 5.8e-18) place HD0830 in the BRCT family which is described as BRCA1 C Terminus (BRCT) domain (PF00533)

PDB Hit:
pdb|1DGS|A Chain A, Crystal Structure Of Nad+-Dependent Dna Lig... 509 5e-145
pdb|1B04|B Chain B, Structure Of The Adenylation Domain Of An N... 303 6e-083

Gene Protein Sequence:
MPLFSQFELSNNITPTQLEALRDQLREYEYHYHVLNNPLVPDAEYDRLIN
QLKNIEQQYPELITPDSPTQRVGAKPLAGFAQVAHEMPMLSLDNAFSETD
LDNFLRRIENYLSLDANQLTFCCEPKLDGLAVSILYIDGVLQLAATRGDG
TTGENITANVRTIRNIPLKLKMANPPHRLEIRGEIFMPLKGFNALNQRAL
AKGEKSFANPRNAAAGSLRQLDPQITRQRPLMLNAYGIGVYESNYQRLPT
SHYARLEWLKSIGIPVNAEIRLARGYPQLLAFYADIQAKRADLGYDIDGT
VLKVDDITIQETLGFISRSPRWAIAYKFPAQEEMTILKDVEFQVGRTGAI
TPVAKLEPTLVAGVTVSNATLHNGDEIERLGVAIGDTVIIRRAGDVIPQI
IGIVADRRPANAKKIVFPTACPVCHSAVIRIAGEAVARCTGGLFCPAQRK
EALKHFVSRKAMNIDGVGEKLIEQLMARELIHTPADLFKLDPLSLMRLER
MGEKSAQNALNSIEKAKHTTLARFLFSLGIRDVGETTALNLANHFGSLEN
IRTANVEQLKEVQDVGEVVANRLVCFWQEQHNVAVVEELIAQGVHWDNIV
QLEIADNPLKDKNVVLTGTLTQFSRDQARKLLQQLGCKVSSAVSTKTDFL
IAGEKAGTKLTKAEQLGIRILDEHAFADLIKQLEYE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCACTATTTTCACAATTTGAACTTAGCAATAACATTACTCCAACACA
GCTTGAAGCATTACGTGATCAATTACGTGAATATGAATATCACTACCACG
TTTTAAACAATCCACTCGTGCCAGATGCAGAATATGACCGCTTGATCAAC
CAATTAAAAAATATTGAGCAACAATATCCTGAATTAATCACGCCGGATTC
CCCCACGCAACGGGTAGGAGCAAAACCCTTAGCAGGGTTTGCACAAGTCG
CACACGAAATGCCGATGCTCTCACTAGATAATGCTTTTTCTGAAACTGAT
TTAGACAATTTTCTACGCCGTATAGAAAATTATCTCTCTCTAGATGCCAA
TCAGCTCACTTTCTGTTGTGAACCCAAATTAGATGGCTTAGCGGTCAGTA
TTTTATATATTGATGGCGTATTACAACTAGCCGCCACACGTGGTGATGGC
ACAACCGGTGAAAATATTACCGCTAATGTTCGCACCATTCGCAATATTCC
ATTAAAACTTAAAATGGCTAATCCGCCCCATCGTTTAGAAATACGCGGGG
AAATATTTATGCCACTAAAAGGCTTTAATGCGTTAAATCAACGCGCCTTA
GCCAAAGGCGAAAAAAGCTTTGCCAATCCGCGAAATGCAGCAGCAGGTTC
ATTACGCCAACTTGATCCACAGATTACTCGTCAACGACCACTAATGTTGA
ATGCCTATGGCATTGGCGTATATGAGTCTAACTATCAACGATTACCTACT
AGCCATTATGCACGGCTAGAATGGTTAAAATCGATTGGCATACCGGTCAA
TGCTGAGATTCGGCTTGCACGAGGTTATCCTCAATTATTGGCGTTCTATG
CTGATATTCAAGCTAAAAGAGCAGATCTCGGTTATGATATTGACGGTACT
GTCTTAAAAGTAGACGATATTACTATTCAAGAAACACTTGGTTTTATTTC
TCGTTCCCCTCGCTGGGCAATTGCCTATAAATTTCCAGCACAAGAAGAAA
TGACCATTTTAAAAGATGTAGAATTCCAAGTGGGTAGAACAGGTGCCATT
ACCCCGGTAGCAAAGCTTGAGCCAACTCTTGTAGCAGGCGTGACCGTCAG
TAATGCTACCTTACATAACGGCGATGAAATTGAACGTTTAGGCGTAGCGA
TTGGCGATACCGTGATCATTCGCCGTGCAGGCGATGTTATTCCACAAATT
ATTGGTATTGTGGCTGATCGTCGCCCGGCTAATGCAAAAAAAATCGTTTT
TCCGACCGCATGTCCAGTCTGTCATTCTGCCGTTATTCGAATAGCTGGCG
AAGCCGTTGCACGTTGTACAGGCGGATTATTTTGCCCAGCACAACGCAAA
GAAGCACTTAAACATTTTGTATCACGTAAAGCAATGAATATTGATGGCGT
AGGTGAAAAATTAATTGAGCAATTAATGGCACGTGAACTCATCCATACTC
CCGCCGATCTATTCAAACTCGATCCACTCAGCCTAATGCGTTTGGAACGG
ATGGGAGAAAAATCTGCTCAAAATGCATTAAACAGTATCGAAAAAGCGAA
GCATACCACCCTTGCTCGATTTTTATTTTCATTAGGTATTCGCGACGTGG
GCGAAACAACCGCGCTAAACTTAGCTAATCATTTTGGGAGCTTGGAAAAT
ATCCGAACCGCTAACGTTGAACAGCTAAAAGAAGTGCAAGATGTAGGTGA
AGTAGTGGCTAATCGCCTAGTTTGTTTTTGGCAAGAACAACATAATGTTG
CGGTGGTCGAAGAATTAATTGCACAAGGCGTACATTGGGATAATATTGTA
CAACTTGAAATTGCCGATAATCCATTGAAAGATAAAAATGTAGTATTAAC
GGGTACACTCACACAATTTAGTCGTGATCAAGCCAGAAAATTGCTACAAC
AGTTAGGATGCAAAGTATCTAGTGCAGTATCAACCAAAACTGATTTTTTG
ATTGCCGGTGAAAAAGCGGGCACTAAGTTGACTAAAGCAGAACAACTTGG
CATTCGTATCTTAGACGAACACGCATTTGCAGATTTAATTAAGCAACTTG
AATACGAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy