Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR589 IGR592 IGR593 IGR596 IGR594 IGR591 IGR595 IGR590 adk, - HD0826 zipA, - HD0831 galE, - HD0829 murG, - HD0824 HD0827 murC, - HD0823 gnd, - HD0833 ligN,lig, - HD0830 cysZ, - HD0832 adk, - HD0826 zipA, - HD0831 galE, - HD0829 murG, - HD0824 HD0827 murC, - HD0823 gnd, - HD0833 ligN,lig, - HD0830 cysZ, - HD0832 adk, - HD0826 zipA, - HD0831 galE, - HD0829 murG, - HD0824 HD0827 murC, - HD0823 gnd, - HD0833 ligN,lig, - HD0830 cysZ, - HD0832
* Calculated from Protein Sequence

Gene ID: HD0829

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
galE  

Definition:
UDP-glucose-4-epimerase

Gene Start:
659392

Gene Stop:
658376

Gene Length:
1017

Molecular Weight*:
37250

pI*:
6.30

Net Charge*:
-4.96

EC:
5.1.3.2  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Galactose metabolism
Nucleotide sugars metabolism

Secondary Evidence:
Bauer,A.J., Rayment,I., Frey,P.A. and Holden,H.M.
The molecular structure of UDP-galactose 4-epimerase from
Escherichia coli determined at 2.5 A resolution
Proteins 12 (4), 372-381 (1992)
MEDLINE: 92253563

Thoden,J.B., Frey,P.A. and Holden,H.M.
Crystal structures of the oxidized and reduced forms of
UDP-galactose 4-epimerase isolated from Escherichia coli
Biochemistry 35 (8), 2557-2566 (1996)
MEDLINE: 96180680

Thoden,J.B., Frey,P.A. and Holden,H.M.
High-resolution X-ray structure of UDP-galactose 4-epimerase
complexed with UDP-phenol
Protein Sci. 5 (11), 2149-2161 (1996)
MEDLINE: 97084800

Thoden,J.B., Hegeman,A.D., Wesenberg,G., Chapeau,M.C., Frey,P.A.
and Holden,H.M.
Structural analysis of UDP-sugar binding to UDP-galactose
4-epimerase from Escherichia coli
Biochemistry 36 (21), 6294-6304 (1997)
MEDLINE: 97317070

Thoden,J.B., Gulick,A.M. and Holden,H.M.
Molecular structures of the S124A, S124T, and S124V site-directed
mutants of UDP-galactose 4-epimerase from Escherichia coli
Biochemistry 36 (35), 10685-10695 (1997)

Thoden,J.B. and Holden,H.M.
Dramatic differences in the binding of UDP-galactose and
UDP-glucose to UDP-galactose 4-epimerase from Escherichia coli
Biochemistry 37 (33), 11469-11477 (1998)
MEDLINE: 98376428

Boels IC, Ramos A, Kleerebezem M, de Vos WM.
Functional analysis of the Lactococcus lactis galU and galE genes and their impact on sugar nucleotide and exopolysaccharide biosynthesis.
Appl Environ Microbiol. 2001 Jul;67(7):3033-40.
PMID: 11425718

Mollerach M, Garcia E.
The galU gene of Streptococcus pneumoniae that codes for a UDP-glucose pyrophosphorylase is highly polymorphic and suitable for molecular typing and
phylogenetic studies.
Gene. 2000 Dec 30;260(1-2):77-86.
PMID: 11137293

Nesper J, Lauriano CM, Klose KE, Kapfhammer D, Kraiss A, Reidl J.
Characterization of Vibrio cholerae O1 El tor galU and galE mutants: influence on lipopolysaccharide structure, colonization, and biofilm formation.
Infect Immun. 2001 Jan;69(1):435-45.
PMID: 11119535



Comment:
For the galU sequence, see HD1431.

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to UDP-glucose-4-epimerase from Pasteurella haemolytica (2494663), H. influenzae (43589), Neisseria meningitidis (7378972), among others. HD0829 is 78% similar to residues 1-336 from GALE_PASHA.

HD0829 is similar to UDP-glucose 4-epimerase from M. pneumoniae (MP0576) and M. genitalium (MG118). Also weakly similar to probable epimerase/dehydratase from T. pallidum (TP0077). No similarities to C. trachomatis, C. pneumoniae, or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1087
COG name: UDP-glucose 4-epimerase
Functional Class: M
The phylogenetic pattern of COG1087 is --t-yq-Ceb-hujgp-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001509 (NAD dependent epimerase/dehydratase family) with a combined E-value of 2.1e-40.
    IPB001509A    3-24
    IPB001509B    75-109
    IPB001509C    197-203
    IPB001509D    231-238
    IPB001509E    303-313
***** IPB002225 (3-Beta hydroxysteroid dehydrogenase/isomerase family) with a combined E-value of 1.3e-06.
    IPB002225A    0-30
    IPB002225B    123-177
    IPB002225C    227-269
    IPB002225D    292-336


ProDom Summary:  Protein Domain Search
Residues 3-333 are 78% similar to a (COMPLETE PROTEOME 4-EPIMERASE REDUCTASE UDP-GLUCOSE NAD) protein domain (PD000038) which is seen in GALE_PASHA.



Paralogs:  Local Blast Search
HD0829 is paralogously related to HD0687 (4e-13) and HD1890 (3e-09).


Pfam Summary:  Pfam Search
Residues 1 to 330 (E-value = 3.9e-06) place HD0829 in the 3Beta_HSD family which is described as 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073)
Residues 3 to 333 (E-value = 1.9e-169) place HD0829 in the Epimerase family which is described as NAD dependent epimerase/dehydratase family (PF01370)

PDB Hit:
pdb|1EK5|A Chain A, Structure Of Human Udp-Galactose 4-Epimeras... 388 4e-109
pdb|1UDC| Structure Of Udp-Galactose-4-Epimerase Complexed Wi... 382 4e-107
pdb|1UDB| Structure Of Udp-Galactose-4-Epimerase Complexed W... 381 5e-107

Gene Protein Sequence:
MAILVTGGAGYIGTHTVVELLNANKEIVILDNLSNSNQIALERIHTITGK
HAKFYLGNILDRAILRKIFAENQIDAVIHFAGSKAVGESVSEPLRYYQNN
VTGSIVLLEEMLTAGINTIVFSSSATVYGDPKTIPIVESCPVGQTTNPYG
TSKYMVERILEDTVNANPQFSAVVLRYFNPIGAHPSGLIGEDPNGIPNNL
LPYISQVAIGKLPQLSIFGNDYDTADGTGIRDYIHVVDVAIGHLKALDKH
HLESGFHVYNLGTGTGYSVLDMVRAFETANHLQIPYQVVDRRPGDIAVCY
SEPSKARQMLGWKTERNLEQMMKDTWHWQKNNPNGYHD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTATTTTAGTAACAGGCGGGGCAGGCTATATTGGCACCCATACCGT
AGTAGAATTATTAAATGCAAATAAGGAGATTGTTATATTAGATAATCTGT
CTAATTCCAATCAAATTGCCCTTGAACGCATACACACCATTACTGGCAAA
CACGCCAAATTTTACTTAGGCAATATCCTCGATCGAGCTATTTTACGCAA
GATTTTTGCCGAAAATCAAATTGATGCGGTCATTCATTTTGCGGGTTCGA
AAGCCGTTGGCGAAAGCGTGTCTGAGCCATTACGCTATTACCAAAATAAT
GTAACCGGTTCGATTGTTTTACTTGAAGAAATGTTAACTGCGGGTATTAA
TACCATTGTATTTAGTTCTTCTGCAACCGTTTATGGCGATCCAAAAACAA
TCCCTATTGTCGAATCTTGCCCCGTGGGGCAAACCACTAATCCTTACGGC
ACATCAAAATATATGGTGGAACGTATTTTAGAAGATACCGTAAACGCAAA
TCCACAATTCAGTGCGGTTGTGTTACGCTATTTTAACCCGATAGGCGCAC
ATCCAAGCGGTTTGATTGGTGAAGATCCAAATGGCATTCCAAACAATTTA
TTGCCTTATATTAGTCAAGTTGCCATTGGCAAACTACCGCAATTATCCAT
ATTTGGCAACGATTACGATACAGCAGATGGCACCGGTATTCGCGATTATA
TTCACGTTGTTGATGTCGCGATTGGCCATTTAAAAGCATTAGACAAACAT
CATTTAGAAAGTGGTTTTCACGTGTATAACCTTGGCACGGGCACCGGTTA
TTCTGTATTAGATATGGTCAGGGCGTTTGAAACGGCTAACCATCTTCAAA
TACCTTATCAAGTGGTTGATCGCCGCCCTGGCGATATTGCCGTTTGTTAT
TCTGAGCCAAGTAAAGCCCGGCAAATGCTCGGTTGGAAGACAGAACGTAA
TCTTGAACAAATGATGAAAGACACGTGGCACTGGCAAAAAAATAATCCAA
ACGGTTATCATGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy