Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR588 IGR587 IGR589 IGR592 IGR593 IGR594 IGR591 IGR590 adk, - HD0826 ftsQ, - HD0820 ddlB, - HD0821 zipA, - HD0831 galE, - HD0829 murG, - HD0824 ftsA, - HD0818 HD0827 murC, - HD0823 ligN,lig, - HD0830 adk, - HD0826 ftsQ, - HD0820 ddlB, - HD0821 zipA, - HD0831 galE, - HD0829 murG, - HD0824 ftsA, - HD0818 HD0827 murC, - HD0823 ligN,lig, - HD0830 adk, - HD0826 ddlB, - HD0821 zipA, - HD0831 galE, - HD0829 murG, - HD0824 ftsA, - HD0818 HD0827 murC, - HD0823 ligN,lig, - HD0830 ftsQ, - HD0820
* Calculated from Protein Sequence

Gene ID: HD0826

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
adk  

Definition:
adenylate kinase

Gene Start:
656930

Gene Stop:
656283

Gene Length:
648

Molecular Weight*:
23610

pI*:
5.70

Net Charge*:
-3.84

EC:
2.7.4.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Maskell,D.J., Szabo,M.J., Butler,P.D., Williams,A.E. and Moxon,E.R.
Molecular analysis of a complex locus from Haemophilus influenzae
involved in phase-variable lipopolysaccharide biosynthesis
Mol. Microbiol. 5 (5), 1013-1022 (1991)
MEDLINE: 92065797

Reinstein,J., Brune,M. and Wittinghofer,A.
Mutations in the nucleotide binding loop of adenylate kinase of
Escherichia coli
Biochemistry 27 (13), 4712-4720 (1988)
MEDLINE: 89000670

Brune,M., Schumann,R. and Wittinghofer,F.
Cloning and sequencing of the adenylate kinase gene (adk) of
Escherichia coli
Nucleic Acids Res. 13 (19), 7139-7151 (1985)
MEDLINE: 86041903


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to adenylate kinase from H. influenzae (97155), E. coli (125161), Neisseria meningitidis (1708605), among others. HD0826 is 83% similar to residues 1-212 from KAD_HAEIN.

HD0826 is similar to adenylate kinase from T. pallidum (TP0595), C. pneumoniae (CPn0244), U. urealyticum (UU251), C. trachomatis (CT128), M. genitalium (MG171), and M. pneumoniae (MP0646).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0563
COG name: Adenylate kinase/yeast uridylate kinase
Functional Class:  F
The phylogenetic pattern of COG0563 is a--kYqvCebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000850 (Adenylate kinase) with a combined E-value of 1.2e-71.
    IPB000850A    4-36
    IPB000850B    76-90
    IPB000850C    111-141
    IPB000850D    156-182
    IPB000850A    22-54


ProDom Summary:  Protein Domain Search
Residues 5-187 are 86% similar to a (KINASE ADENYLATE TRANSFERASE ATP-BINDING) protein domain (PD000657) which is seen in KAD_HAEIN.



Paralogs:  Local Blast Search

HD0826 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 187 (E-value = 2.8e-93) place HD0826 in the ADK family which is described as Adenylate kinase (PF00406)
Residues 123 to 158 (E-value = 6.4e-20) place HD0826 in the ADK_lid family which is described as Adenylate kinase, active site lid (PF05191)

PDB Hit:
pdb|1AKE|A Chain A, Adenylate Kinase (E.C.2.7.4.3) Complex With... 319 2e-088
pdb|1E4V|A Chain A, Mutant G10v Of Adenylate Kinase From E. Col... 315 3e-087
pdb|1E4Y|A Chain A, Mutant P9l Of Adenylate Kinase From E. Coli... 311 4e-086

Gene Protein Sequence:
MKVILLGAPGAGKGTQAQFIMHKFGIPQISTGDMFRAAIKEGTELGKQAK
ALMDQGKLVPDDLTVALVKDRIAQPDCAHGFLLDGFPRTIPQADALKDAG
VKIDLVLEFDVADEVIVERMSGRRVHQPSGRTYHIIYNPPKVAGQDDITG
EELITRADDKAETVLERLAVYHQQTKPLIAYYIAEAEKGNTRYERLDGTK
PVEQVSAELANIFNQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTTATCCTATTAGGTGCACCCGGCGCAGGTAAAGGCACACAAGC
ACAATTCATTATGCATAAATTTGGTATCCCACAAATTTCAACGGGTGATA
TGTTCCGTGCAGCAATTAAAGAAGGAACAGAATTAGGTAAACAAGCAAAA
GCATTAATGGATCAAGGAAAATTAGTGCCTGATGATTTAACGGTTGCATT
AGTAAAAGATCGTATCGCTCAACCAGATTGCGCCCATGGCTTTTTATTAG
ATGGTTTCCCACGTACTATTCCACAAGCCGATGCATTAAAAGATGCCGGT
GTAAAAATTGATTTAGTTCTAGAATTTGATGTTGCTGACGAAGTTATTGT
AGAACGGATGAGTGGCCGCCGTGTTCATCAACCATCAGGGCGAACATACC
ATATCATATACAATCCACCTAAAGTAGCAGGTCAAGATGATATTACTGGC
GAAGAATTAATCACCCGTGCTGATGATAAAGCCGAAACGGTATTAGAACG
TTTAGCCGTATATCATCAACAAACGAAACCGCTTATCGCTTACTATATTG
CTGAAGCCGAAAAAGGCAATACGCGCTATGAGCGTTTAGATGGCACTAAA
CCGGTTGAGCAAGTCAGCGCTGAATTAGCTAATATTTTCAACCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy