Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR588 IGR587 IGR585 IGR589 IGR586 IGR592 IGR591 IGR590 adk, - HD0826 ftsQ, - HD0820 ddlB, - HD0821 galE, - HD0829 murG, - HD0824 ftsZ, - HD0817 ftsA, - HD0818 HD0827 murC, - HD0823 adk, - HD0826 ftsQ, - HD0820 ddlB, - HD0821 galE, - HD0829 murG, - HD0824 ftsZ, - HD0817 ftsA, - HD0818 HD0827 murC, - HD0823 adk, - HD0826 ftsQ, - HD0820 ddlB, - HD0821 galE, - HD0829 murG, - HD0824 ftsZ, - HD0817 ftsA, - HD0818 HD0827 murC, - HD0823
* Calculated from Protein Sequence

Gene ID: HD0823

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
murC  

Definition:
UDP-N-acetylmuramate-alanine ligase

Gene Start:
654876

Gene Stop:
653449

Gene Length:
1428

Molecular Weight*:
51820

pI*:
6.20

Net Charge*:
-6.51

EC:
6.3.2.8  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
D-Glutamine and D-glutamate metabolism
Peptideglycan biosynthesis

Secondary Evidence:
Ikeda,M., Wachi,M., Jung,H.K., Ishino,F. and Matsuhashi,M.
Nucleotide sequence involving murG and murC in the mra gene cluster region of Escherichia coli
Nucleic Acids Res. 18 (13), 4014 (1990)
M:90326550

Eveland,S.S., Pompliano,D.L. and Anderson,M.S.
Conditionally lethal Escherichia coli murein mutants contain point
defects that map to regions conserved among murein and folyl
poly-gamma-glutamate ligases: identification of a ligase
superfamily
Biochemistry 36 (20), 6223-6229 (1997)
M:97309380

Liger,D., Masson,A., Blanot,D., van Heijenoort,J. and Parquet,C.
Over-production, purification and properties of the
uridine-diphosphate-N-acetylmuramate:L-alanine ligase from
Escherichia coli
Eur. J. Biochem. 230 (1), 80-87 (1995)
M:95324553

El Zoeiby,A., Sanschagrin,F., Lamoureux,J., Darveau,A. and
Levesque,R.C.
Cloning, over-expression and purification of Pseudomonas aeruginosa murC encoding uridine diphosphate N-acetylmuramate: L-alanine ligase
FEMS Microbiol. Lett. 183, 281-288 (2000)

Comment:
For other "mur" genes, see HD1906 (murI), HD0242 (murE), HD0243 (murF), HD0245 (murD), HD0253 (murA), HD0081 (murB), HD0824 (murG).

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to UDP-N-acetylmuramate-alanine ligase from H. influenzae (1171071), E. coli (127536), Pseudomonas aeruginosa (6523805), among others. HD0823 is 75% similar to residues 1-474 from MURC_HAEIN.

HD0823 is similar to muramate-ala ligase & D-ala-D-ala ligase from C. pneumoniae (CPn0905) and C. trachomatis (CT762), to UDP-N-acetylmuramate--alanine ligase from T. pallidum (TP0341), and to N-Acetylmuramoylalanylglutamyl DAP Ligase (CPn0418), (CT269, CT758), and (CPn0901). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0773
COG name: UDP-N-acetylmuramate-alanine ligase
Functional Class:  M
The phylogenetic pattern of COG0773 is -----qvcEbrHuj--olinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001645 (Folylpolyglutamate synthetase) with a combined E-value of 1.7e-06.
    IPB001645A    120-144
    IPB001645D    427-460


ProDom Summary:  Protein Domain Search
Residues 16-186 are 79% similar to a (LIGASE CELL SYNTHETASE PEPTIDOGLYCAN SYNTHESIS) protein domain (PD001083) which is seen in MURC_HAEIN.

Residues 190-266 are 63% similar to a (LIGASE SYNTHETASE CELL PEPTIDOGLYCAN SYNTHESIS ENZYME) protein domain (PD212530) which is seen in Q9KPG8_VIBCH.

Residues 255-307 are 66% similar to a (LIGASE SYNTHETASE CELL PEPTIDOGLYCAN) protein domain (PD039273) which is seen in MURC_HAEIN.

Residues 320-471 are 80% similar to a (LIGASE SYNTHETASE CELL PEPTIDOGLYCAN SYNTHESIS) protein domain (PD001216) which is seen in MURC_PASMU.

Residues 190-287 are 41% similar to a (COMPLETE ORF MITOCHONDRION PROTEOME) protein domain (PD000146) which is seen in MURC_BUCAI.



Paralogs:  Local Blast Search


HD0823 is paralogously related to HD0703 (3e-38), HD0245 (8e-14), HD0243 (1e-05) and HD0242 (7e-04).


Pfam Summary:  Pfam Search
Residues 54 to 314 (E-value = 2e-73) place HD0823 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 323 to 416 (E-value = 6.6e-28) place HD0823 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKSYQDNIKKLVPEMRRVKQIHFVGIGGAGMSGIAEVLLNEGYQISGSDI
VESIVTKHLADAGAKIFIGHQAENIAGASVVVVSSAIEENNPEITAAKSA
RIPVIQRAQMLAEIMRFRHSIAVAGTHGKTTTTAMLSMIYTEAGLDPTFV
NGGLVKSAGKNAHLGASRYLIAEADESDASFLHLQPMLSVVTNIEPDHMD
TYGGDFEQMKTIYVKFLRNLPFYGLAVMCADDDVVMEIAPQVGRQVISYG
FNANADYRIENYQQTGFQGHYTVICPNNERLDVVLNVPGHHNALNATAAL
AVAKEEGIANDAILAALADFQGAGRRFDPLGTFKRPNGTVMLIDDYGHHP
TEIAVTIKAARQGWQHKRIVMIFQPHRYSRTRDLFDDFVNVLSKVDVLIM
LDVYAAGENAIVKADSKALCRSIRNLGKVDPILVSDTSQLGEVLDQIIQD
NDLILAQGAGNISKLTRKLAEDWQA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGCTATCAAGATAATATTAAAAAATTAGTTCCAGAGATGCGCCG
TGTTAAGCAAATTCACTTTGTTGGTATCGGCGGTGCGGGTATGAGTGGCA
TTGCCGAAGTGTTATTAAATGAAGGCTATCAAATTTCAGGATCGGATATT
GTCGAAAGTATTGTCACTAAACATTTGGCTGACGCTGGCGCAAAGATCTT
TATTGGTCATCAAGCTGAGAATATTGCCGGCGCTAGCGTGGTAGTCGTGT
CTAGTGCTATTGAGGAAAATAACCCTGAAATCACCGCTGCAAAATCTGCT
CGTATTCCGGTTATCCAACGCGCGCAAATGTTAGCTGAAATTATGCGTTT
TCGTCATAGTATCGCAGTAGCTGGTACACACGGTAAAACGACCACTACTG
CAATGTTATCCATGATTTATACTGAAGCCGGTTTAGATCCAACATTTGTT
AACGGTGGCTTAGTTAAATCAGCGGGTAAAAATGCACATTTAGGTGCAAG
CCGTTATCTCATTGCAGAAGCAGATGAAAGTGATGCTTCTTTTTTACATC
TACAACCAATGTTATCCGTTGTGACGAATATTGAACCGGATCATATGGAT
ACTTATGGTGGCGATTTTGAACAAATGAAAACCATTTACGTAAAATTTTT
ACGTAATTTGCCGTTCTATGGATTAGCCGTGATGTGTGCCGACGATGATG
TGGTTATGGAAATTGCACCTCAAGTTGGTCGCCAAGTGATTAGCTACGGT
TTTAATGCTAATGCTGATTATCGTATTGAAAACTATCAACAAACCGGTTT
TCAAGGTCATTACACCGTTATCTGCCCAAATAATGAGCGCTTGGATGTAG
TATTAAATGTACCGGGCCATCATAATGCCTTAAATGCAACCGCGGCATTA
GCCGTCGCTAAAGAAGAAGGTATCGCGAATGACGCTATTTTAGCAGCATT
AGCAGATTTCCAAGGAGCAGGACGTCGTTTTGATCCGCTAGGAACATTTA
AACGGCCAAATGGAACGGTGATGCTAATAGATGATTATGGCCATCACCCT
ACAGAAATCGCAGTCACCATTAAAGCAGCTCGACAAGGTTGGCAGCACAA
ACGAATTGTGATGATTTTCCAACCTCACCGCTATTCACGTACACGTGATT
TATTTGACGATTTTGTTAATGTGCTATCCAAAGTAGATGTCTTAATTATG
CTAGATGTATATGCAGCAGGTGAAAACGCAATTGTTAAAGCAGATAGCAA
AGCATTATGCCGTTCTATTCGAAATTTAGGTAAAGTCGATCCTATTTTAG
TTTCGGATACAAGTCAGTTAGGTGAAGTTTTAGATCAAATTATTCAAGAT
AATGATTTAATCCTAGCACAAGGTGCCGGTAACATCAGTAAACTTACCCG
CAAATTGGCTGAAGATTGGCAAGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy