Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR581 IGR582 IGR588 IGR587 IGR585 IGR580 IGR586 IGR583 IGR584 ftsQ, - HD0820 ddlB, - HD0821 lpxC,envA, - HD0816 ftsZ, - HD0817 ftsA, - HD0818 murC, - HD0823 recN, - HD0815 artQ, - HD0813 artM, - HD0814 artI, - HD0812 artP, - HD0811 ftsQ, - HD0820 ddlB, - HD0821 lpxC,envA, - HD0816 ftsZ, - HD0817 ftsA, - HD0818 murC, - HD0823 recN, - HD0815 artQ, - HD0813 artM, - HD0814 artI, - HD0812 artP, - HD0811 Type: tandem, Name:  - 12 ftsQ, - HD0820 ddlB, - HD0821 lpxC,envA, - HD0816 ftsZ, - HD0817 ftsA, - HD0818 murC, - HD0823 recN, - HD0815 artQ, - HD0813 artM, - HD0814 artI, - HD0812 artP, - HD0811
* Calculated from Protein Sequence

Gene ID: HD0816

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lpxC  envA  

Definition:
UDP-3-O-acyl-GlcNAc deacetylase

Gene Start:
649157

Gene Stop:
648237

Gene Length:
921

Molecular Weight*:
34199

pI*:
5.70

Net Charge*:
-5.44

EC:
3.5.1.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Arginine and proline metabolism
Histidine metabolism
Lipopolysaccharide biosynthesis
Nicotinate and nicotinamide metabolism
Pantothenate and CoA biosynthesis

Secondary Evidence:
Beall,B. and Lutkenhaus,J.
Sequence analysis, transcriptional organization, and insertional
mutagenesis of the envA gene of Escherichia coli
J. Bacteriol. 169 (12), 5408-5415 (1987)
M:88058745

Hyland,S.A., Eveland,S.S. and Anderson,M.S.
Cloning, expression, and purification of UDP-3-O-acyl-GlcNAc
deacetylase from Pseudomonas aeruginosa: a metalloamidase of the
lipid A biosynthesis pathway
J. Bacteriol. 179 (6), 2029-2037 (1997)
MEDLINE: 97221605

Young,K., Silver,L.L., Bramhill,D., Caceres,C.A., Stachula,S.A.,
Shelly,S.E., Raetz,C.R.H. and Anderson,M.S.
The second step of lipid A biosynthesis, UDP-3-O-acyl-GlcNAc
deacetylase is encoded by the pleotropic permeability/cell division gene envA of E.coli
FASEB J. 7, 1268-1268 (1993)

Kloser,A.W., Laird,M.W. and Misra,R.
asmB, a suppressor locus for assembly-defective OmpF mutants of
Escherichia coli, is allelic to envA (lpxC)
J. Bacteriol. 178 (17), 5138-5143 (1996)
MEDLINE: 96359366



Comment:
For other "lpx" genes, see HD1187 (lpxA), HD1189 (lpxD), HD0846 (lpxB).

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to UDP-3-O-acyl-GlcNAc deacetylase from H. influenzae (1170828), E. coli (119388), Pseudomonas aeruginosa (1890655), among others. HD0816 is 74% similar to residues 1-305 from LPXC_HAEIN.

HD0816 is similar to UDP-3-O-acyl-GlcNAc deacetylase from C. trachomatis (CT533), and to Myristoyl GlcNac Deacetylase from C. pneumoniae (CPn0652). No similarities to T. pallidum, U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0774
COG name: UDP-3-0-acyl-N-acetylglucosamine deacetylase
Functional Class:  M
The phylogenetic pattern of COG0774 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-276 are 75% similar to a (DEACETYLASE COMPLETE PROTEOME) protein domain (PD011499) which is seen in Q9CPA5_PASMU.



Paralogs:  Local Blast Search


HD0816 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 281 (E-value = 2.6e-166) place HD0816 in the LpxC family which is described as UDP-3-O-acyl N-acetylglycosamine deacetylase (PF03331)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIKQRTLKQATTVTGIGLHSGQKVKLTLRPAPANTGIIYARTDLTPAVYF
TADANLVGDTTLCTCMINDDGVRISTVEHLNAAVSALGLDNLIIEVNAPE
VPIMDGSSSPFIYLLLDAGIEEQESPKKFIRIKQTVRIEDGDKWAELKPY
NNGLKLDFTIEFNHPMISKDVRHFNMELSAKNFIHNISRARTFTFMKDVE
YLQSMGLALGGSLDNAIVLDEYRILNEEGLRYKDELVKHKMLDSIGDLFM
CGYNILGEFTAYKSGHGLNNKLLRAVLANKNAWEFVTFDDTQQAPQGYQI
GEQVFI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAAACAAAGAACACTAAAACAAGCAACTACTGTTACAGGTATCGG
CTTACATAGTGGTCAAAAAGTCAAGTTAACCTTACGGCCTGCTCCTGCTA
ATACCGGCATTATTTACGCTCGCACAGATTTAACGCCAGCGGTCTATTTT
ACTGCAGATGCGAACTTGGTCGGTGATACAACCTTATGTACTTGTATGAT
CAACGATGATGGAGTACGCATTTCAACAGTAGAACATTTAAATGCGGCTG
TTTCAGCATTAGGCCTTGATAATTTAATTATTGAAGTCAATGCCCCAGAA
GTTCCTATTATGGATGGTAGTTCAAGTCCATTTATTTATCTCTTATTAGA
TGCGGGTATTGAAGAACAAGAATCACCGAAAAAATTTATCCGCATTAAGC
AAACCGTCCGAATAGAAGATGGTGATAAATGGGCAGAATTAAAACCTTAC
AATAATGGTTTAAAATTAGATTTTACTATAGAGTTTAATCACCCAATGAT
CAGCAAAGATGTCCGCCACTTCAATATGGAATTATCTGCTAAAAATTTTA
TCCATAATATTAGTCGTGCTAGAACGTTTACATTTATGAAAGATGTTGAA
TATTTGCAATCTATGGGGCTAGCATTAGGTGGTAGCCTAGATAATGCGAT
TGTATTAGATGAATATCGAATCTTAAATGAAGAAGGTTTACGCTATAAAG
ATGAGTTGGTAAAACATAAAATGCTTGATTCAATTGGCGATCTATTTATG
TGTGGTTATAATATTCTCGGTGAATTTACCGCTTATAAATCTGGCCATGG
CTTGAATAATAAATTATTACGTGCTGTATTAGCGAATAAAAATGCTTGGG
AATTTGTAACATTTGATGATACACAACAAGCACCTCAAGGTTACCAGATT
GGTGAACAAGTATTTATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy