Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR573 IGR572 IGR580 IGR577 IGR578 IGR575 IGR574 IGR570 IGR571 IGR576 IGR579 HD0806 HD0801 yraP, - HD0800 HD0805 HD0810 dsbD,cycZ, - HD0807 lppC, - HD0803 HD0809 HD0799 artI, - HD0812 artP, - HD0811 HD0804 HD0798 HD0806 HD0801 yraP, - HD0800 HD0805 HD0810 dsbD,cycZ, - HD0807 lppC, - HD0803 HD0809 HD0799 artI, - HD0812 artP, - HD0811 HD0804 HD0798 HD0806 HD0801 yraP, - HD0800 HD0805 HD0810 dsbD,cycZ, - HD0807 lppC, - HD0803 HD0802 HD0802 HD0809 artP, - HD0811 HD0804 HD0798 HD0799 artI, - HD0812
* Calculated from Protein Sequence

Gene ID: HD0805

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
639705

Gene Stop:
638902

Gene Length:
804

Molecular Weight*:
29958

pI*:
10.50

Net Charge*:
15.68

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 17-267 are 39% similar to 12721933 unknown [Pasteurella multocida].

No similarities to C. trachomatis, C. pneumoniae, T. pallidum, U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 17-267 are 39% similar to a (PROTEOME COMPLETE PM1543) protein domain (PD400812) which is seen in Q9CKR3_PASMU.



Paralogs:  Local Blast Search
HD0805 is paralogously related to HD2037 (7e-31).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKIKPLVLAISAMPVLATASVGDINLYTKVGTDISSRFESFKISHLAKSA
MPKNHSKSSINLFLESTYSLTDNTEVGLGIGYVKRKGQNHVGQQEFLRNA
WEVLNRDQSNGADIHKIDKVIVKEEYKVNRYSSIPLYVTLKQNFPLIQGI
DLYLKGDMGYAFNKSKSTAYHFLSTLIGKDIQSPNGKERFDALVKTKLNH
GLYYGIALGVQYKNLLAEVGYYHTNAKIAYNLNKLSLLTKTLELLPPLPQ
KTSYKNDAIRLSVGFRF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTAAACCTCTTGTTCTAGCCATATCCGCTATGCCTGTTTTAGC
CACAGCAAGTGTCGGTGATATCAATCTCTATACTAAAGTGGGAACAGATA
TAAGCTCTCGTTTTGAATCATTTAAGATCAGCCACTTAGCTAAAAGTGCA
ATGCCAAAAAATCATAGCAAATCTTCTATTAATCTCTTTTTAGAATCAAC
TTATAGCTTAACTGACAATACAGAGGTCGGGTTAGGTATTGGCTATGTTA
AGCGTAAAGGCCAAAATCACGTTGGGCAACAAGAGTTTTTGCGTAATGCT
TGGGAAGTTTTGAACAGAGATCAATCTAATGGTGCAGATATACATAAGAT
AGATAAAGTTATAGTAAAAGAAGAATACAAAGTGAATCGTTATTCTTCTA
TTCCGCTTTATGTTACCTTAAAACAGAACTTTCCGTTAATTCAAGGTATT
GATCTTTATCTAAAAGGTGACATGGGCTATGCTTTCAATAAATCAAAAAG
TACCGCATATCATTTCTTAAGCACATTAATTGGCAAAGACATCCAATCTC
CCAATGGAAAAGAGCGCTTTGATGCCCTCGTAAAAACCAAATTAAATCAC
GGGCTTTATTATGGCATTGCATTAGGTGTACAATACAAAAATTTATTAGC
TGAAGTGGGTTATTACCATACTAACGCTAAAATTGCATATAATCTCAATA
AGCTATCACTTCTCACTAAAACATTAGAATTATTACCACCATTGCCGCAA
AAAACCTCATACAAAAATGATGCAATTCGTCTTTCTGTTGGTTTTAGATT
CTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy