Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-1 tRNA-Ser-2 IGR573 IGR572 IGR570 IGR571 IGR569 IGR567 IGR568 HD0801 yraP, - HD0800 lppC, - HD0803 HD0799 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 HD0801 yraP, - HD0800 lppC, - HD0803 HD0799 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 HD0801 yraP, - HD0800 lppC, - HD0803 HD0802 HD0802 HD0799 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 HD0794 ordL, - HD0797 HD0794 ordL, - HD0797
* Calculated from Protein Sequence

Gene ID: HD0797

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ordL  

Definition:
probable oxidoreductase

Gene Start:
632303

Gene Stop:
632797

Gene Length:
495

Molecular Weight*:
18220

pI*:
9.70

Net Charge*:
3.66

EC:
1.-.-.-  

Functional Class:
Unassigned  

Pathway: pathway table

Secondary Evidence:
Jovanovic G, Model P.
The RIB element in the goaG-pspF intergenic region of Escherichia coli.
J Bacteriol. 1997 May;179(10):3095-102.
PMID: 9150200

Comment:
0

Blast Summary:  PSI-Blast Search
Some significant hits using gapped BLAST to putative oxidoreductase from H. influenzae (1175687), Neisseria meningitidis (7225844), E. coli (1709492), among others. HD0797 is 80% similar to residues 280-431 from ORDL_HAEIN.

No similarities to C. trachomatis, C. pneumoniae, T. pallidum, U. urealyticum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 5 clades of COG0665
COG name: Predicted oxidoreductases
Functional Class:  R
The phylogenetic pattern of COG0665 is amtKyq-CEBRhuj--o-in-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 62-123 are 80% similar to a (OXIDOREDUCTASE PROTEOME COMPLETE OXIDASE SARCOSINE) protein domain (PD001376) which is seen in ORDL_HAEIN.

Residues 124-164 are 73% similar to a (ORDL OXIDOREDUCTASE PROTEOME NAD) protein domain (PD176747) which is seen in ORDL_HAEIN.

Residues 13-60 are 87% similar to a (OXIDOREDUCTASE PROTEOME COMPLETE ORDL) protein domain (PD400000) which is seen in ORDL_HAEIN.



Paralogs:  Local Blast Search

HD0797 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LLQSHLIKVWQTSLINNGMSVCDNNLLLDYYRLSADNRLLFGSDSSSNVD
MVAQMRAEMLAVFPQLAEAKIDYGWAGPIDMTLNSTPHFGRAKKNVYFAQ
GFSGHGVALTGLAGRIIAEAISGNDERLAIFESLKVPSIYGGKWVKQLAL
KIGVPYYRFLDKYR$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTACAGAGCCACTTGATCAAAGTATGGCAGACAAGTTTAATTAATAA
TGGTATGTCTGTTTGTGATAATAATTTATTATTGGATTATTATCGTTTAT
CAGCAGATAATCGCTTATTATTTGGCAGTGATTCTAGTAGTAATGTTGAT
ATGGTTGCACAGATGCGTGCGGAAATGTTGGCAGTATTTCCTCAGTTAGC
TGAGGCAAAAATTGATTATGGTTGGGCTGGTCCGATTGATATGACGCTGA
ATTCAACCCCTCATTTTGGCCGTGCTAAAAAAAATGTTTATTTCGCGCAG
GGATTTTCTGGACATGGTGTTGCTTTAACAGGGCTCGCAGGGCGGATCAT
TGCTGAGGCGATTAGTGGTAATGATGAACGATTGGCTATTTTTGAAAGCT
TAAAAGTGCCGAGCATTTATGGTGGTAAATGGGTGAAACAGTTGGCATTA
AAAATAGGTGTGCCATATTATCGTTTTCTTGATAAATATCGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy