Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-1 tRNA-Ser-2 IGR572 IGR565 IGR570 IGR571 IGR569 IGR567 IGR566 IGR568 HD0801 yraP, - HD0800 HD0799 ccmD, - HD0790 ccmE, - HD0791 ccmC, - HD0789 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 HD0801 yraP, - HD0800 HD0799 ccmD, - HD0790 ccmE, - HD0791 ccmC, - HD0789 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 yraP, - HD0800 HD0801 HD0799 ccmE, - HD0791 ccmC, - HD0789 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 HD0794 ordL, - HD0797 HD0794 ordL, - HD0797 ccmD, - HD0790
* Calculated from Protein Sequence

Gene ID: HD0795

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glpE  ynjE  

Definition:
thiosulfate sulfur transferase

Gene Start:
629672

Gene Stop:
630877

Gene Length:
1206

Molecular Weight*:
45546

pI*:
5.70

Net Charge*:
-5.40

EC:
2.8.1.1  

Functional Class:
Central intermediary metabolism; Sulfur metabolism  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 7-379 are 38% similar to 18144713 probable thiosulfate sulfur transferase [Clostridium perfringens.

Some significant hits using gapped BLAST to putative thiosulfate sulfurtransferase from E. coli (3916038, 1742867), Deinococcus radiodurans (7473971), Mycobacterium tuberculosis (3122949), among others. HD0795 is 34% similar to residues 64-427 from YNJE_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0607
COG name: Rhodanese-related sulfurtransferases
Functional Class: P
The phylogenetic pattern of COG0607 is amT-YQ-CEBRHuj--o---x
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001307 (Rhodanese signatures) with a combined E-value of 1.8e-13.
    IPB001307A    92-102
    IPB001307C    160-179
    IPB001307D    185-210
    IPB001307G    352-364


ProDom Summary:  Protein Domain Search
Residues 7-153 are 26% similar to a (YNJE TRANSFERASE SULFURTRANSFERASE) protein domain (PD117671) which is seen in YNJE_ECOLI.

Residues 164-375 are 41% similar to a (TRANSFERASE SULFURTRANSFERASE THIOSULFATE PROTEOME) protein domain (PD003053) which is seen in YNJE_ECOLI.



Paralogs:  Local Blast Search
HD0795 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1ORB| Thiosulfate:cyanide Sulfurtransferase Mol_id: 1; M... 64 3e-011
pdb|1RHD| Rhodanese (E.C.2.8.1.1) 64 3e-011

Gene Protein Sequence:
MPNEEAHIKGAIQFTATWLDNIAADKFESFAAGKGITKAKKLVFYDTDPD
NLERVSTEFAAKGYRVSIFKDFIDYANHTDYPLDSFPNFKYSVSPQWLNA
VIQGEQPETYQNNQFMVFEVSWGSLENAKNYTQHIVGAYHFNTDWIENAP
VWNLSDANVIEQHLLQNGITKDKTIILYSDNQLAAYRVFWALKWAGVEDV
RVLNGNLASWIDANFATETKVNLPQPATSFGATIPVNPQIDIITPQQVME
RQQQGLKLISNRAWNEYIGKVSGYDYIHGKGEPQNAIWGYAGTDSSNMAD
YYDPDNTLRNPNEMFNLWKKQGIRQGDQLAFYCGTGWRAGVSWFITQLAG
WQNTFIYDGGWNAWQMDSKFPVQKGAPQKMSKPDAHNDFGKIIKKGQSCK
N$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCAACGAGGAGGCACATATTAAAGGTGCGATTCAATTTACAGCAAC
GTGGCTAGATAATATTGCTGCGGATAAATTTGAATCTTTTGCCGCAGGTA
AAGGCATCACTAAAGCAAAAAAATTAGTATTCTATGATACTGATCCAGAT
AATTTAGAACGCGTTTCAACAGAGTTTGCCGCTAAAGGTTATCGGGTAAG
CATTTTTAAAGATTTCATTGACTATGCGAATCATACGGATTATCCGCTTG
ACTCTTTTCCAAATTTTAAATACAGCGTTTCGCCACAATGGCTGAACGCA
GTAATACAAGGTGAACAGCCAGAAACTTATCAGAATAATCAATTTATGGT
GTTTGAAGTTTCATGGGGCAGTTTGGAAAACGCAAAGAATTATACACAAC
ACATTGTCGGCGCTTATCACTTTAATACGGATTGGATCGAAAATGCACCC
GTTTGGAATTTGTCTGATGCTAACGTGATTGAACAGCATCTATTGCAAAA
TGGCATTACTAAAGATAAAACGATAATTCTTTATTCTGATAATCAATTGG
CAGCCTATCGAGTGTTTTGGGCATTGAAATGGGCTGGTGTAGAAGATGTA
CGCGTATTGAATGGCAATTTAGCGAGTTGGATTGATGCAAATTTTGCTAC
CGAAACAAAAGTTAATTTACCACAACCTGCCACAAGTTTTGGCGCAACGA
TTCCGGTGAATCCGCAGATTGATATTATTACGCCTCAACAAGTGATGGAG
CGACAGCAACAAGGTTTGAAATTAATTAGCAATCGTGCTTGGAATGAATA
TATAGGCAAAGTGAGTGGTTATGATTATATTCACGGCAAGGGAGAGCCTC
AAAATGCTATTTGGGGCTATGCGGGTACTGATTCAAGCAATATGGCGGAT
TACTACGATCCCGATAATACCTTACGCAATCCAAATGAAATGTTTAATTT
ATGGAAAAAACAAGGGATCCGACAAGGTGATCAACTAGCCTTTTATTGTG
GTACCGGCTGGCGAGCTGGCGTATCGTGGTTTATTACCCAATTAGCGGGT
TGGCAGAATACTTTTATTTATGATGGTGGCTGGAATGCTTGGCAAATGGA
TTCAAAATTCCCGGTGCAAAAAGGCGCGCCACAAAAAATGAGTAAACCAG
ATGCCCATAATGATTTTGGTAAAATAATCAAAAAAGGACAATCGTGTAAA
AATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy