Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-1 tRNA-Ser-2 IGR565 IGR564 IGR570 IGR571 IGR569 IGR567 IGR566 IGR568 HD0799 ccmD, - HD0790 ccmE, - HD0791 ccmB, - HD0787 ccmC, - HD0789 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 HD0799 ccmD, - HD0790 ccmE, - HD0791 ccmB, - HD0787 ccmC, - HD0789 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 HD0799 ccmD, - HD0790 ccmE, - HD0791 ccmC, - HD0789 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 HD0794 ordL, - HD0797 HD0794 ordL, - HD0797 ccmB, - HD0787
* Calculated from Protein Sequence

Gene ID: HD0794

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
hypothetical protein

Gene Start:
629443

Gene Stop:
629697

Gene Length:
255

Molecular Weight*:
9493

pI*:
6.80

Net Charge*:
-0.35

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits using gapped BLAST.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD0794 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LLTIHNVGFNIHIKDRTMMKINTSLLVIAMSMVLTACDNVAVKPIEITEL
VNNLDNPNYLVIDTRHDSFYNGFKEQNAQRGGTY$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTAACAATACACAATGTCGGCTTTAATATACATATAAAGGATAGAAC
AATGATGAAAATTAACACAAGTTTATTAGTGATTGCTATGAGTATGGTTT
TAACCGCCTGTGATAATGTTGCAGTTAAGCCAATTGAAATAACAGAATTA
GTGAATAATTTAGATAATCCCAACTACCTAGTTATTGATACGCGTCATGA
TAGTTTTTATAACGGTTTTAAAGAACAGAATGCCCAACGAGGAGGCACAT
ATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy