Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-1 tRNA-Ser-2 IGR565 IGR564 IGR569 IGR567 IGR566 IGR568 ccmD, - HD0790 ccmE, - HD0791 ccmB, - HD0787 ccmC, - HD0789 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 ccmD, - HD0790 ccmE, - HD0791 ccmB, - HD0787 ccmC, - HD0789 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 ccmD, - HD0790 ccmE, - HD0791 ccmB, - HD0787 ccmC, - HD0789 ordL, - HD0796 yeeE, - HD0793 glpE,ynjE, - HD0795 HD0798 ccmF, - HD0792 HD0794 ordL, - HD0797 HD0794 ordL, - HD0797
* Calculated from Protein Sequence

Gene ID: HD0793

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
yeeE  

Definition:
transport system permease protein

Gene Start:
628455

Gene Stop:
629471

Gene Length:
1017

Molecular Weight*:
36665

pI*:
9.50

Net Charge*:
10.03

EC:
 

Functional Class:
Transport and binding proteins; Other  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Few significant hits using gapped BLAST to conserved hypothetical protein from E. coli (465569), Thermotoga maritima (7462169]), Campylobacter jejuni (6968925) among others. HD0793 is 36% similar to residues 20-336 from YEEE_COLI

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 97-331 are 36% similar to a (TRANSMEMBRANE AMYA-FLIE PROTEOME) protein domain (PD404843) which is seen in YEEE_ECOLI.



Paralogs:  Local Blast Search
HD0793 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 64 to 128 (E-value = 6.3e-06) place HD0793 in the DUF395 family which is described as YeeE/YedE family (DUF395) (PF04143)
Residues 272 to 335 (E-value = 4.8e-11) place HD0793 in the DUF395 family which is described as YeeE/YedE family (DUF395) (PF04143)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MYSGLFIGLLFGILLQRGQFCFVAGFRNLFKQADLRFLTALLLAISIQAI
GFFSLAIFGLITIPTTSLPLLATLSGGFLFGFGMQLANACVSGACLRASE
GVFGGWIVLCCFALTMAAAETGSLKHWLYPLLTETTEIDNIYNTLAISPW
LLVGLLLVVTTILLYYQIKTPRYRPANPVSKAIIFPKFFAQHWQIYLVAI
LLGILSVLAWWLSAKTGRDAGLSIAVPVANLVQYLVTGQQRYLNWGSLSV
LGMLIGAFISAKLSGEFRVVMPPVQVILPRIVGGICMGVGAALAGGCTVT
NALVATAYFSWQAWLATLMMVIGCWVATYFVNNTQCRL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATTCTGGTCTATTTATTGGTCTCTTGTTTGGGATCTTACTGCAACG
TGGGCAATTCTGTTTTGTCGCGGGTTTCCGCAATTTATTTAAGCAAGCTG
ATCTTCGTTTTTTAACGGCATTATTGCTTGCCATTTCTATTCAAGCTATT
GGTTTCTTTAGTTTAGCTATATTTGGTTTAATCACTATTCCAACTACTTC
ATTACCTCTTCTTGCTACACTAAGCGGTGGTTTTCTGTTTGGTTTTGGTA
TGCAATTGGCTAATGCTTGTGTAAGTGGTGCCTGTCTTCGTGCGAGTGAA
GGGGTTTTTGGTGGTTGGATTGTTTTATGCTGTTTTGCATTGACGATGGC
TGCGGCAGAAACAGGCAGTCTTAAACATTGGCTTTATCCGTTGTTAACGG
AAACGACAGAGATCGATAATATTTATAACACTTTAGCTATTTCTCCTTGG
TTATTAGTTGGCTTATTGCTGGTAGTAACCACTATTCTTCTTTATTACCA
AATAAAAACGCCCCGCTATCGACCGGCGAATCCAGTATCAAAAGCGATTA
TTTTTCCGAAATTTTTTGCTCAGCATTGGCAAATTTATCTAGTGGCAATA
TTGCTTGGTATATTAAGTGTGCTAGCTTGGTGGTTAAGCGCTAAGACGGG
GCGTGATGCCGGCTTGAGTATTGCTGTGCCTGTAGCGAATTTGGTGCAAT
ACCTAGTTACCGGGCAACAGCGCTATCTAAATTGGGGATCTTTATCTGTA
TTAGGTATGTTAATAGGGGCATTTATTTCGGCGAAATTAAGTGGCGAGTT
TCGGGTCGTGATGCCACCTGTACAAGTTATTTTGCCACGTATAGTTGGTG
GGATATGTATGGGCGTGGGGGCCGCTTTAGCGGGCGGTTGTACGGTAACA
AATGCATTAGTCGCGACAGCTTACTTTTCTTGGCAGGCTTGGCTTGCCAC
ATTAATGATGGTAATCGGTTGTTGGGTTGCGACATATTTTGTTAACAATA
CACAATGTCGGCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy