Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-4 tRNA-Ile-3 rRNA-16S-4 rRNA-23S-4 IGR560 IGR559 IGR558 IGR557 IGR556 IGR561 oadG, - HD0784 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 oadB, - HD0782 oadA, - HD0783 oadG, - HD0784 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 oadB, - HD0782 oadA, - HD0783 oadG, - HD0784 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 oadB, - HD0782 oadA, - HD0783
* Calculated from Protein Sequence

Gene ID: HD0784

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
oadG  

Definition:
oxaloacetate decarboxylase gamma chain

Gene Start:
616097

Gene Stop:
615840

Gene Length:
258

Molecular Weight*:
9496

pI*:
10.60

Net Charge*:
2.46

EC:
4.1.1.3  

Functional Class:
Transport and binding proteins; Cations  

Pathway: pathway table
Arginine and proline metabolism
Pentose and glucuronate interconversions
Pyruvate metabolism

Secondary Evidence:
Woehlke,G., Wifling,K. and Dimroth,P.
Sequence of the sodium ion pump oxaloacetate decarboxylase from Salmonella typhimurium.
J. Biol. Chem. 267(32):22798-22803,1992.
Medline: 93054591.

Laussermair,E., Schwarz,E., Oesterhelt,D., Reinke,H., Beyreuther,K. and Dimroth,P.
The sodium ion translocating oxaloacetate decarboxylase of Klebsiella pneumoniae. Sequence of the integral membrane-bound subunits beta and gamma.
J. Biol. Chem. 264(25):14710-14715,1989.
Medline: 89359264.

Bott,M., Pfister,K., Burda,P., Kalbermatter,O., Woehlke,G. and Dimroth,P.
Methylmalonyl-CoA decarboxylase from Propionigenium modestum--cloning and sequencing of the structural genes and purification of the enzyme complex.
Eur. J. Biochem. 250(2):590-599, 1997.
Medline: 98088990.

Schmid M, Vorburger T, Pos KM, Dimroth P.
Role of conserved residues within helices IV and VIII of the oxaloacetate decarboxylase beta subunit in the energy coupling
mechanism of the Na+ pump.
Eur J Biochem. 2002 Jun;269(12):2997-3004.
PMID: 12071964


Schmid M, Wild MR, Dahinden P, Dimroth P.
Subunit gamma of the oxaloacetate decarboxylase Na(+) pump: interaction with other subunits/domains of the complex and binding
site for the Zn(2+) metal ion.
Biochemistry. 2002 Jan 29;41(4):1285-92.
PMID: 11802728

Comment:
For other "oad" genes, see HD0783 (oadA) and HD0782 (oadB).

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 14423822 and 6503183 in GenBank.

Four significant hits using gapped BLAST to oxaloacetate decarboxylase gamma chain. Positions 35 to 105 are 73% (E value 8e-20) similar to gb|AAF14625.1|AF200362_1 (6503183) oxaloacetate decarboxylase gamma chain between positions 1 and 71 in Haemophilus ducreyi. Positions 23 to 100 are 44% (E value 2e-09) similar to sp|P13155|DCOG_KLEPN (118355) oxaloacetate decarboxylase gamma chain between positions 4 and 80 in Klebsiella pneumoniae.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-80 are 60% similar to a (DECARBOXYLASE GAMMA CHAIN LYASE) protein domain (PD027443) which is seen in Q9CL26_PASMU.



Paralogs:  Local Blast Search
HD0784 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 83 (E-value = 2e-27) place HD0784 in the OAD_gamma family which is described as Oxaloacetate decarboxylase, gamma chain (PF04277)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTNAELFGEGINLMIAGMGFVMFFLIILIYAISVISRLINKYFPDPTQTP
PAQPIPAVIPPTDLERLRPVIVAAIAHHRRQQRSN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAAATGCAGAACTTTTTGGTGAAGGTATAAATCTCATGATAGCGGG
AATGGGCTTTGTAATGTTCTTTCTAATCATTCTAATTTATGCAATTAGTG
TTATTTCTCGGCTAATTAATAAATATTTTCCTGATCCGACACAGACCCCA
CCAGCGCAACCTATTCCAGCTGTTATTCCACCCACTGATTTAGAGCGCTT
ACGTCCGGTAATTGTAGCTGCAATTGCACATCATCGCCGTCAACAGCGTT
CAAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy