Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap rRNA-16S-4 IGR560 IGR552 IGR551 IGR559 IGR553 IGR555 IGR558 IGR554 IGR557 IGR556 IGR561 oadG, - HD0784 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 oadB, - HD0782 oadA, - HD0783 HD0778 HD0776 HD0777 HD0775 fabH, - HD0774 plsX, - HD0773 oadG, - HD0784 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 oadB, - HD0782 oadA, - HD0783 HD0778 HD0776 HD0777 HD0775 fabH, - HD0774 plsX, - HD0773 oadG, - HD0784 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 oadB, - HD0782 oadA, - HD0783 HD0777 HD0775 fabH, - HD0774 plsX, - HD0773 HD0778 HD0776
* Calculated from Protein Sequence

Gene ID: HD0780

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
yhjA  ccp  

Definition:
probable cytochrome c peroxidase

Gene Start:
612101

Gene Stop:
611622

Gene Length:
480

Molecular Weight*:
18126

pI*:
9.10

Net Charge*:
3.15

EC:
1.11.1.5  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 6503187 in GenBank.

Residues 1-145 are 51% similar to 12721260 unknown [Pasteurella multocida].

Two significant hits using gapped BLAST to cytochrome c peroxidase from E. coli (586681, putative) and Zymomonas mobilis (5834301). HD0780 is 30% similar to residues 7-148 from YHJA_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-145 are identical to a (PEROXIDASE C CYTOCHROME CYTC) protein domain (PD133582) which is seen in Q9RF96_HAEDU.



Paralogs:  Local Blast Search
HD0780 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKKYLLSALAVGGIGYFSLVGYAYWFDTEQAPKLLEKAALPESHQAVANI
MFENGRHYCHTPDAELPAYAKLPIASQLMAQDIERGTRFFRFDRLLDGMK
DPSKLSEADLAKLEQVIRNDEMPIAKYVHVHWGSRPDETQKKPFLTGFTN
NVKRTSYRT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAATATCTTCTTTCAGCATTAGCTGTTGGCGGTATTGGCTATTT
TTCTTTAGTCGGCTATGCGTACTGGTTTGATACAGAACAAGCGCCCAAAT
TACTTGAAAAAGCAGCATTACCCGAATCACATCAAGCTGTCGCCAACATC
ATGTTTGAAAATGGCCGCCATTATTGCCATACGCCTGATGCAGAATTACC
GGCTTACGCTAAATTACCTATCGCGAGTCAATTAATGGCACAAGACATCG
AAAGAGGCACACGTTTCTTCCGTTTCGACCGCCTACTTGACGGCATGAAA
GATCCAAGCAAACTTTCTGAAGCTGACCTAGCGAAACTTGAACAAGTTAT
CCGCAACGACGAAATGCCGATTGCCAAATATGTACATGTTCACTGGGGAT
CACGTCCTGACGAAACACAGAAAAAGCCATTCTTGACTGGATTCACCAAC
AACGTAAAGCGCACTTCCTACCGAACGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy