Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR560 IGR552 IGR559 IGR551 IGR549 IGR550 IGR553 IGR555 IGR558 IGR554 IGR557 IGR556 oadG, - HD0784 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 oadB, - HD0782 oadA, - HD0783 rpL32, - HD0772 HD0778 HD0776 HD0771 HD0777 HD0775 fabH, - HD0774 plsX, - HD0773 oadG, - HD0784 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 oadB, - HD0782 oadA, - HD0783 rpL32, - HD0772 HD0778 HD0776 HD0771 HD0777 HD0775 fabH, - HD0774 plsX, - HD0773 oadG, - HD0784 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 oadB, - HD0782 oadA, - HD0783 HD0771 HD0777 HD0775 fabH, - HD0774 plsX, - HD0773 rpL32, - HD0772 HD0778 HD0776
* Calculated from Protein Sequence

Gene ID: HD0779

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ccp  

Definition:
cytochrome c peroxidase

Gene Start:
611304

Gene Stop:
610699

Gene Length:
606

Molecular Weight*:
22900

pI*:
5.40

Net Charge*:
-5.64

EC:
1.11.1.5  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table

Secondary Evidence:
Wilming M, Iffland A, Tafelmeyer P, Arrivoli C, Saudan C, Johnsson K.
Examining Reactivity and Specificity of Cytochrome c Peroxidase by using Combinatorial Mutagenesis.
Chembiochem. 2002 Nov 4;3(11):1097-104.
PMID: 12404635

Rosenfeld RJ, Hays AM, Musah RA, Goodin DB.
Excision of a proposed electron transfer pathway in cytochrome c peroxidase and its replacement by a ligand-binding channel.
Protein Sci. 2002 May;11(5):1251-9.
PMID: 11967381

Comment:
0

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 6503187 in GenBank.

Several significant hits using gapped BLAST to cytochrome c peroxidase from E. coli (586681, probable), Campylobacter jejuni (6967525), Aquifex aeolicus (7433005), among others. HD0779 is 52% similar to residues 271-457 from YHJA_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1858
COG name: Cytochrome c peroxidase
Functional Class:  P
The phylogenetic pattern of COG1858 is -----q--e---uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-192 are 99% similar to a (PEROXIDASE CYTOCHROME PROTEOME COMPLETE) protein domain (PD010012) which is seen in Q9RF96_HAEDU.



Paralogs:  Local Blast Search

HD0779 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 64 (E-value = 8.2e-06) place HD0779 in the CCP_MauG family which is described as Di-haem cytochrome c peroxidase (PF03150)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MGSKTWDEILARLDQDEEFKQRFFAVYPHLTQETVTDAIGEFEKTLITPN
SAFDRFLKGDQTALTDVQKRGYEHFQKAKCDTCHTGTAMGGQSFEYLGLY
GDYFKDRGTPLTEADEGRFAVTKDPSDKHRFKVPTLRNVALTAPYMHDAS
AKDLKEAVRIMGHYQSNKDFSENELNEIVAFLESLTGEYQGKTLTNEKMI
K$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCTCAAAAACATGGGATGAAATTTTAGCGCGCTTAGATCAAGATGA
AGAATTTAAACAACGCTTCTTTGCCGTCTATCCGCACTTAACACAAGAGA
CCGTAACCGATGCCATTGGTGAATTTGAGAAAACATTAATCACACCAAAC
AGCGCCTTTGACCGCTTCTTAAAAGGCGACCAAACCGCCTTAACGGATGT
ACAAAAACGTGGTTACGAACATTTCCAAAAAGCTAAATGCGACACCTGTC
ATACCGGCACGGCAATGGGTGGTCAATCCTTTGAATACTTAGGCTTATAC
GGCGATTACTTCAAAGATCGTGGCACACCATTAACTGAAGCAGATGAAGG
CCGTTTTGCAGTAACCAAAGATCCAAGCGACAAACACCGCTTCAAAGTGC
CTACATTACGTAACGTTGCCTTAACCGCACCTTATATGCACGATGCAAGC
GCTAAAGACCTCAAAGAGGCGGTACGGATTATGGGACATTATCAAAGTAA
TAAAGACTTCTCAGAAAACGAATTAAACGAAATTGTCGCCTTCTTAGAAT
CACTAACCGGCGAATACCAAGGTAAAACCCTAACTAACGAAAAAATGATC
AAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy